SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07265T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07265T0
Domain Number 1 Region: 151-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000367
Family EGF-type module 0.0079
Further Details:      
 
Weak hits

Sequence:  PTSG_07265T0
Domain Number - Region: 90-155
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00126
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07265T0
Sequence length 1593
Comment | PTSG_07265 | Salpingoeca rosetta predicted protein (1594 aa)
Sequence
MNAMLQQQNEDRRWQVQCSSINGGSLTNCRFGPQENTYNNPLEYNAPVTAVITGLASSHA
NRNEDRVWSFQTCGVTCDKDNGYKLVDRACELQSCSSLSLVNGVTEGACSGNYGDACKYK
ECNTGYELSMFGSLTRTCDWIGSEVDWLGTAKECTDIDECLTGENDCYPGSVCVNTEGSF
DCVCEFGAQQENSCLVEIPTITLNLGLTEMTINIDGDWGNTFPKYRVSVARWSYDLAAKE
DIPGFPKTVRKPFTSHRVIRLEAGTRFRVTLTPVGNNDEEIPYFSQLALTPEGNDPQTIC
GCIPEDPTGAPTDFRIRQFKGHVLFRWADQSQCESAFSFTRNGVGLTSRFPVTEQLACGA
IQEPNTVYDDLTIQSAGDYAEVDEALNYLLPEGEFYLRRFLAVDTGDTRFMYPHELQRQK
THFSSTSTTTTAAPQGVPDDENRYYPGTSSPVASVSECKDLCDIRSDWCIAFAVQTKGDD
TLVCHQLRIIETATLRAGEKKAVSFERVTVTGTGVDGSYIFDGTQDDCEEACSAHGSCDM
TMVAAGVCAVVVDAVETETPLTQSVHPDIDPTFSRRIPGPEPGTTQEYCIEANKPEWYDL
QGYSSDPTCTSFTIMWESQLEGQIAIDSKEIHLPVEGVEVEFEIGGLVRGRRITNEDGKF
FIHILSDKLVGSRHRMTLRFSKTTGNIKHTFTCGGIACTETTLIMEHLRFDHQVNVRDTT
SLPFSGIVSIGGTEHEGLPDGCPLKDVEVCLYDRHQANTLINCDVTDSKGRYLVRAVLGT
SVTVGLSYGNSSHTFERIPYASDAANAPSGILQTINALNALERTLYYDVTDGKFWENINF
KDTTSDRGTVDIAGGLCNLNLGDAVMEFRYDACPTWVKTHTISDRLSKWTLPAQIITVRF
KEITRNYEVRGEITRYFSAKLGNSRSLYLDLRNPQEDDEDKKTVRFEYHPPPQLSVSFDK
EEKHNCNSTEGDRPMHVIKQNVELKATVKVIEDYGEGVGTCDAVPGQIEVENQLGESPAI
VDVLNVTTSLTDKQLNKLKQCYDTCLMDVKMDEELQDGETVYSNTRIELSIMTGEPETNP
DAVNPENPYSKLFRVTMHNLPQDPVTVYEKVVVVGDKVISKYFSVPFPRYQPLAVVQDPP
GGLSTVTYSKAYSNYFMKSHTHEEYHGFYFTRGLAPVEVKTGVQQCTGLGAAVCTKVSDT
ESTPFKISLDQLDSINSKNPDDNYNSERVWSFAIELTTSDDVMTAGEKSDMFLVPALNVV
WLETEEVSFDVEQCQAAKETKVKWSLEGQENREVLSWVSAFEIENKELPDLRKLLALAEE
PPGDDDDETEEDRAEKIAELKRAIKAWESNLDRNKEVRQKAADGLLEPVQNMWAKGNAEF
DCLPSIAPNKDPKEAAKIQSELSRTQVCNAFDVDRIADKAKKGISLAPHDDIDNAKDLDG
LAASDQDKQDLRNIDTIKFSGGGSTYTFEYDLSRGDSVIGGSSRTAEVSVGVAFEFGFKV
FGVGMSFEMATGYNYKGTVADEYEVGVSTEGILSVTLGDPDPFDVFDVGVFLHPDYGTFV
FATFSGQSSCPHEPNTVQLEKPSARAARRTRRL
Download sequence
Identical sequences PTSG_07265T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]