SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07426T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07426T0
Domain Number 1 Region: 62-224
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.45e-23
Family YicI catalytic domain-like 0.011
Further Details:      
 
Domain Number 2 Region: 225-307
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000000165
Family Putative glucosidase YicI, domain 3 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07426T0
Sequence length 474
Comment | PTSG_07426 | Salpingoeca rosetta hypothetical protein (475 aa)
Sequence
MSGKNYSAYDIPGGWMIPNDGYGCGYTRLAYVISQLHDLGKYTALWTSTGLANATWEIGT
AGSRGIKTDVGWVGAGYKFELDAVKLASSLIEDNTSERRYVWSVCGWAGTHAYAVMWNGD
NGGSWEYIRFQIPTVLGSGLSAQAHTSGDIDGIFAGSAETYVRDIQWKCFLTVLMTMSGW
ARYDKQPWRRGEPYTSYSRKYLKLKMRLLPYQYTYSYIAHTTGTPPARATVLEYPHDPIA
LDNTTAYQFFSGEWLLVAPMFEKGDRRDGIYLPADEFIDYWNGTRYEGPQTINNYYAPLA
ILPVFVKAGAIIPMWPAMNYFYELPRVPITLDVYPPTISASDDPRVSSFTLYEDDGLSRE
HEKGAFAQQNFTMNARHGVVELVIGPLVGSYKTINDTRFYEVTAHVTGAVSDVLQDSNAL
PQYTTVEDLEFVNQGYVYDASDRRGVVTVKLDGLHRTQSTTIFIHHATGTTNIA
Download sequence
Identical sequences PTSG_07426T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]