SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07443T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07443T0
Domain Number 1 Region: 1096-1420
Classification Level Classification E-value
Superfamily NHL repeat 9.42e-29
Family NHL repeat 0.00032
Further Details:      
 
Domain Number 2 Region: 619-685
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000306
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 3 Region: 366-424
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000132
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 4 Region: 435-489
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000195
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 5 Region: 552-619
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000375
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 6 Region: 675-742
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000153
Family Complement control module/SCR domain 0.0051
Further Details:      
 
Domain Number 7 Region: 896-967
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000167
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 8 Region: 479-556
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000278
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07443T0
Sequence length 1421
Comment | PTSG_07443 | Salpingoeca rosetta NHL repeat-containing protein (1422 aa)
Sequence
MLNRGSASAMSTVAATLLIAALIYMQPAEAYVNEYLEDVYFRCDTGEGLTYMTSKYSDNK
YDRRWDFSCAPIGTASSDTQSSGGYDVRDLYSNNNYDCASGYYMEKLESTYSSVDRLWKY
TCRRPNNVQLLNSSYENSRTGNLDYDITGTNKIITGLYSKYTDTVFEWDRRWKITTCEVE
CDLTGDYVNSDVPRVCTTLSPSGITNGNFVADYQEPFGSYCETSTAITTISTQFAASSTD
RRWAFTCTKPTSGGQVITSQTWSTPAYGKLGTAFTVSCPSNTYITGVKSAYVSSFQDRVY
SFQCTGYENTEISAVNCNGAVAVNAAGADFDFSTSSGAYVITSLTSTFDSSTSDREWTFT
ECKPQCVDGTMLNSDGYCSGDECTFESCNTGYEFSSAATTRTCDADGAWSGADITCEPIT
CNRLTHSQITLIGSCSGNYGDVCTYYSCPSGYALRGTTFSRECTADGWTGTEPYCELLEC
SELTAPTNGWRGDTCTGTLGSTCERGCNDGFVLSPTEASGGFTRTCTETTDSDGLAVAEW
TGSERTCITVDCGEIVLANGQTTGECSGNYDDTCTYDECDTGYALSSGGSTRRTCGVTDG
VAAWSGTSKQCEVVTCSSIEVQNGVTSGTCDGTVGGECSFTCDTGYWPSSSGSTTTTCVL
NADGHSASWDATIATCTEVMCPTLTLEYGSVSGSCSGTVGDVCVYDSCDDGFVFGIGGSS
SRTCIQDEDTAYWDGDEKTCLETIEGDGGTNFTIACAAGQAITGLYYTSGTDTYEILCQD
AGASLSKRIYASAETLTVSGNTAQYCDFDTYAVSGVSKKGSTLVYDCSLLAGAELVDCTL
GDTLSGSYSILAPEGSVFAGIYNTDSTSPQVRVCDVRCREEDGFYSVGGTKCRQLSCGAL
TLTNGATSGTCSGAKGDTCTYESCNYGYELSASGDTSRTCSITNGRAEWSGVAKTCQPIS
TTGSPTTVNACEGLSRSLNPATCRERCERNNEDSTFMATYGGCTRVCTCGCRKRFEITQE
EDDCSAHCASQGLDASFFEEHEGCRNVCLCFEASTRSTATTVTTTTEVTFTTQVTGTVET
IAGNGLVDWTGSSDPTATGLNQAECVAVDVTGATYIAIRHRVVSISRDGSTITTIAGTKT
RGSAGVGGLATAAQLDRPTCVAVDTIGNVYISEKGNHRVSVVDASTGVLSVFVGTGEAGH
RGMGGSSRAAQIHSPHGLAFDSRGTLYIADTENHVVYGVDRRSLVIDVVAGTPFRKGYHG
DGRPATTAWLNAPTGIAVRGAGDLYIADTGNNRIRYVDLDSDNIIDTLVGTGRYGGDVDG
STTTAALETNLDHPEGVAVNAEGTTLVIADTNKHVLRSVSLNGDDSPVTVLAGTGSRGFN
GDGNDPTATKFRSPVSVAYDIGERAIVFVDQQNRRIRRVHL
Download sequence
Identical sequences PTSG_07443T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]