SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07477T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07477T0
Domain Number 1 Region: 633-712
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000247
Family Growth factor receptor domain 0.0068
Further Details:      
 
Domain Number 2 Region: 301-443
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000139
Family Growth factor receptor domain 0.0047
Further Details:      
 
Domain Number 3 Region: 155-209
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000239
Family Complement control module/SCR domain 0.0032
Further Details:      
 
Weak hits

Sequence:  PTSG_07477T0
Domain Number - Region: 486-667
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000687
Family Growth factor receptor domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07477T0
Sequence length 899
Comment | PTSG_07477 | Salpingoeca rosetta predicted protein (900 aa)
Sequence
MGSQGRGALAVALLAAAALCAPIADAYPYYYSGCQISVGETAMSHTVTAVSDGDSDCDIE
GFPTEYFEGETYTINLNGRSGLMFLVSVDSGTLAKKDSNSFTSKSGCSSTAGYGNLDTQV
EWTAGSASSASITLTCGSNSFGLLQATESGSKGEVVTCDSPPSVDNGTPCSSATHIQPDC
DVQCSSGYELTANTIQCQPDGNFTGSATCSDIDACESHDVCDPNSNGCMDIAGGPDSEDG
ITCGGCTTGYTGDGFTCEDIDGCNPVPCDADATCADVAAPGTGATCTCNEGFFGDGSTCT
ACTVCPENTYAVGECHTTAGDYDSCDACPGNSTSPADSKSIDDCTCNEGFTKMTSGNSFV
CEPIVCPEGEFLDGDTCSACTPTTCPAGEELQGQCGGSTNTLSCQPCTGGTAKDAAGAGM
CTTCPWGTEPNSDHTDCVACPAGHAGIGGSCTLCGNGTQPSTNGSVCVACQPGWAGTLGL
CSACGQDKVASSDKTACVTCGANAVPNTMHAACVCDTTSVVTSPWPLTCTPCGDGTRPNW
NQTACVPCQPGWAGTNGWCSACSSNLVPNMARTACVACPAPFRASADGVRCMPPRCGESD
GTDARQCSPCPGCHCPRTHVPVVDTIGAIEYVSCDLCPPELVPVAGTCRPCPQNRVSFNG
RCLACASGYGVYNATTCLPCKGVNISMDGVCVGCPAGQVPDETRTRCQNVTQQNIYFALD
YAQFEQDAQARWEFIGAVLEALQAHGIDTSAIVQVLLRPGSTVVELVGAGWALQAAKDAA
AAGTVVVVHNGANATAGDTLTADGTVVSSSVEGSTDSSGSSGGGASTTEDLSAGTVAGVF
AGVFAGAFVVFLIAACQTKSRHVMHSKRSTSKLEIDLTTEDGDVSSASSPWDNVQVSDL
Download sequence
Identical sequences F2UIU4
XP_004990982.1.12839 PTSG_07477T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]