SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07498T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07498T0
Domain Number 1 Region: 182-534
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.53e-70
Family NagZ-like 0.00026
Further Details:      
 
Domain Number 2 Region: 535-766
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 2.75e-49
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0068
Further Details:      
 
Domain Number 3 Region: 66-170
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.66e-19
Family Ricin B-like 0.0012
Further Details:      
 
Domain Number 4 Region: 32-85
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.00000564
Family Ricin B-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07498T0
Sequence length 900
Comment | PTSG_07498 | Salpingoeca rosetta beta-glucosidase (901 aa)
Sequence
MMTNLHCWRALALVVATVAAVVAATVTGAEGVWEGPSVTIQPCTTKRAAYQQWTRGPKNE
IVLKSNGSCLDVQGYSTADQATVYTFSPCHPDDPDPSHQNEAWSINANGTITELMSGKCL
DRSQYGTSPGTQVWLYHCTGVYNQNWIYNKTDLTIRANDSGLCLDAGSPTPRTCDVEPGK
SLPFCNTALSYDDRIRDLISRINDSDLPGLLVNSATGVEHLNLPAYQWWSEALHGVGHSP
GVHFGGDVPAATSFPQVIHTGATFNKTLYRKIGTVISTEARAMNNVQRAGNTFWGTTTLV
FAQRTFTSAQETPGEDPFATGEYAANFVSGFQDGEDMNYIKASSCCKHFFDYNLENWHGV
DRHHYNAIATDQDIADTYLPSFEACVRYGRASGLMCSYNAVNGVPSCANGDIMTVMARES
WGFDGYITSDCGAVADVLNSHKFTRNTSETIRAVLEAGMDTDCGSFVQQYLAKAMQEGVV
PRELVNTALHRLFMVQFRLGLFDPVSKQPYTNYSVARVNTPANQQLALEAAQQGIVLLKN
TNARLPLKTGLHVALIGPNADATTVMQGNYQGTAPFLISPVRGFKNYSAAVTYAKGCDVA
CKDTSGFDAAVAAAKEADAVVVVVGLDQGQESEGHDRTSITLPGHQEDLVAQVAAAAKSP
IVVFVMTGGAVDLSTIKANKNVAGILWCGYPGQSGGQAMADVVFGAVSPGGRLPYTIYPG
SYVDACSMLDNGMRPNKTSGNPGRTYRFYTGKPVYEYGTGLSYTSFSYHIHYLNTMDTSL
ATVQTYVQDAKQNHKFIRYDAPEFTRVEVNVTNVGRVAGADVVQVFVEPKTPAELGAPIK
TLIGFERVFLNPGQWTIVQFSVNAHDLTFVDASGKRVARAGEWLVHIGHDSRLTFPVHVN
Download sequence
Identical sequences PTSG_07498T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]