SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07501T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07501T0
Domain Number 1 Region: 1537-1817
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.97e-67
Family Protein kinases, catalytic subunit 0.00000553
Further Details:      
 
Domain Number 2 Region: 600-712
Classification Level Classification E-value
Superfamily L domain-like 0.0000000000000284
Family L domain 0.016
Further Details:      
 
Domain Number 3 Region: 265-339,376-408
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000863
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 430-545
Classification Level Classification E-value
Superfamily L domain-like 0.0000000187
Family L domain 0.027
Further Details:      
 
Domain Number 5 Region: 1124-1254
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000213
Family Fibronectin type III 0.0056
Further Details:      
 
Weak hits

Sequence:  PTSG_07501T0
Domain Number - Region: 1302-1343,1406-1492
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000165
Family Fibronectin type III 0.005
Further Details:      
 
Domain Number - Region: 165-193
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000251
Family EGF-type module 0.064
Further Details:      
 
Domain Number - Region: 204-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0805
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07501T0
Sequence length 1910
Comment | PTSG_07501 | Salpingoeca rosetta notch-1 (1911 aa)
Sequence
MNIVLVLGVLLATLAAPATGECITVYKYDDFYSGKYDGSDGNVNWGDKWSEHDTLNGGYS
SGQAYVANEHLVLSNPGLETDPSRLPYVHRRVDLSTWTQGTVYLGLRYSFYGLVESHDVI
NVEISADDGKTYEVFTVITGATGSTTTLFADVLDSKYLTSHTRLRGGTCVELETGLACIC
PAGYFGSSCQCTIGVDEEEECNDLPSCSPSPCKNGGVCVIDTLARSARSLDPITGTLTDT
TLRTTTPTSTKTGKVAATTASPISLPDRFTCQCPDGLTGSTCADDVDECARADSAGISLC
GDHGTCTNTFGGYTCTCTVGFAGDHCDEDINECEVGALLVQFTDTNTLIDGAELLLSSTF
TSATTTTTTTTRLAACDNGGVCTNTIGGFTCECPPNTLGTRCELTLACSTLPDPFIISDA
RTLALFANLACVDVLGGLIIRDIDASQLDLASALASLRVVEKYLVVEDVSNLDLAALQHI
TAIATTPLASDRFADTFGLVLRSNANMTASTALPLHDLVALVQNGDIDITDNADFCLQAE
QQLTPANTTAPYWWAVEPRLTLQTAPSCPSCFLHNATLSQDVAGLGSAGDGVCASQCTDC
PQVCTLEEPITTTTAARALLERDCSIIQGDLIVTDLSSGALAVLTDALASVTAVTGDVVV
DGVRSLTTLDALLPELESAASLVITNNPNLISISLPNLQTQHGTTQANNPSLVLDGEGGG
SGGDAASTTITTLRTEVTFDLTLEELKLVTRADPGVLQSYLMDAYTRVVSTNPDLSALFS
LLNETTVGFSVDHQGQQVAVVVEAEASVAAVQLATEQINAYGAANLLSGAFDQNSRTDLE
VTTNPSNGMGLRLRLLPPVVRPFSTELRWRGPTSPGTNTSDVTTTNVVFVRPDADRLART
ILHLNSGNGNAHAGSSSSSSSSSSSSSLSSRVGITTSAESLGIAQELRELYAWLNTNLGA
SVAITHSNFVALLQTLLPWQSVPVDGNHAFIRACSSSSSSSSSTTTSSVLFATSDDDDQS
GGSGVCMLRGVPYEIKLLAYVHAGDVASPVVESNIVSATLPLASPDHLRVHSRVQQSSGT
SIDLGWDTDVPHDNVLVQLYAPSRAYQAARDDPENAPFDTELLAPSSSSASSSSSRSAAR
EWLVPSTAAKNITVGGCITALRFGTDSSSSSNSQLVQHCVKPFELYLVSVRLIGGIVPTE
RSLSYVRTPPAAPSSPLRSVQTSALTATSISIRGQIPIEANGIVEEVLVTLEEARVPRPD
DTTTTTTTAGDDGEWTQLSARRIRLANSAAAQINNPDVFVDTTIADLHPHRRYRARIHPG
TTAGFASTAMATALHFQTNPAQPLAPERLRAVVHTGSVPAGTVVLTAALEIGPSAGANAN
AAGAQQATTTAAVTTGSDEGAAEMVVVEVSWGEPSEDLGFLEEYEVIVSSSNTTASAVSA
TPSASEGSSVVVYSGTNTTVYVRMPLAAVLSVRGRTAAGWGEYAAAVAPQVPSSSQGNTS
TTSTLILPLAIAGCGAMLIVVLGVIALRRKEVLLARLYGFKRPVPDEYEILRDQIETTRM
VDAGAFGEVYAGTGTDLLGSSVPRNVAVKICQGSHVTTKAKRAFLKEMQIMKTLTYPRHP
NVLGLMGQVTQSEPLMMVTELVARGNLRTVLHDNKPVKNKPSVLALHRLLGFARDVASGM
NHLVDNNIVHCDLAARNCLVTATWHVKICDFGRAFCTDDEAPTAVHDRSVMPVRWMPPEV
LTANFYTHASDVWSFGVTCFEMFSYAQTPYAGMSNEQVEQLVVNSGKKLAQPKFCPDGAY
ALMQQTWAYKPSNRPIFAVLAAGFSDLETRMRHGGNDADLVCSAGLDVVYSGSNMGTLLS
RQSVGTVQRRLSQDSILQDYYVNQSLGLVDNVVVLEPDGRDPMTNGDTTL
Download sequence
Identical sequences PTSG_07501T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]