SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07512T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07512T0
Domain Number 1 Region: 314-360
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000174
Family TNF receptor-like 0.0047
Further Details:      
 
Weak hits

Sequence:  PTSG_07512T0
Domain Number - Region: 237-277
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00224
Family TNF receptor-like 0.015
Further Details:      
 
Domain Number - Region: 92-160
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0864
Family TNF receptor-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07512T0
Sequence length 432
Comment | PTSG_07512 | Salpingoeca rosetta predicted protein (432 aa)
Sequence
MTVVLMVTVMAGSCRQCAAQDFKPNFYCTDNPCNDVSYEVSGETGCPHTDHACLCVDEAF
VESFPAGCECRDGLTRTVDTSGTSPSGFVCGPCTVCDHFHIKASPCMPEQDTVCVNCATA
CEPGAYVDACGSSSVACEPCTSCEAQSQFEAAPCTSTSDTLCCDACADAEQFVAEPCTRT
TAATCTACTRCVDGLEFELRACGLTTDRVCQACTTTCAGPHEHVVTPCTPTSDAQRGCLP
GYFESVPETPTSSRECIPCPQGTTDHDRDGTTACMACPFAITNTTANAGPCEELQCAPGT
SGSQSCQPCAPPSHYQPLGGQTMCLNTTLCRPGFVEEQPPTPTTDRVCVACGHGTFSNVT
ADGAGSCVNWRTCAVLTEQYILGDGTSSTDRACAALTPCTPSQFEQQPPTRFHDRVCANI
SAPCDVGSTEYE
Download sequence
Identical sequences PTSG_07512T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]