SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07521T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07521T0
Domain Number 1 Region: 475-678
Classification Level Classification E-value
Superfamily Smc hinge domain 6.41e-45
Family Smc hinge domain 0.00067
Further Details:      
 
Domain Number 2 Region: 1-219,1127-1215
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.2e-43
Family ABC transporter ATPase domain-like 0.0000797
Further Details:      
 
Weak hits

Sequence:  PTSG_07521T0
Domain Number - Region: 645-768
Classification Level Classification E-value
Superfamily Tropomyosin 0.000347
Family Tropomyosin 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07521T0
Sequence length 1240
Comment | PTSG_07521 | Salpingoeca rosetta conserved hypothetical protein (1241 aa)
Sequence
MRLDRLELENFKSYGGHCVIGPFTAFSAVIGPNGSGKSNLMDAISFVLGVRARELRGAQL
KDLIYSSDSATKGKLRAKVSAVFVDANDEDADELILSRSISAKGSSDYKINGKAVTWEQY
DERLQSLGLLVKAKNFLVFQGDVENIAAKSPKQLTQLFEQISGSAALRDEYEAAKKARDE
AEADHLFFQQQKKGLYTERKQYQQQKEEADRFQQLQDELAATRREHILWQLYNIEQDMTE
ESDALQTKLKTFNKLTRKGEAAKATLKDHNKKVAAAAKARMNAKKDLKNQEKKVHKLTPQ
HVAIQTKLKHAKGRLAANAKLLQSARADQQRADEEVHELQDELEKVEAAQERYDNTLAEE
SQHDEIQLGQEEMEMYNQLKAKAASETHDLKTTCDKATRLYEAKQREVQREQKQKEEIKT
KMAALEKEIATQSERLKRLQENLNRQQKDMQQKERDVQRAKQERQEMTQQKGELSSKIET
VKASLREANAYRKESARNRRLNDAIATMKQLFPGVHGKMIDLCEPRHSRYKVAVTVIMGS
NMDAVVVDSSDVAMECLKYLRENQIGTATFIPLESVKVKDVKEHLRQLPNGSKLVRDVID
FPPRIERAVQYACGNAVVCETEKEAKRLVFSEGAASKTVSLKGTVIKASGEMQGGLAGVE
MKAKRWDEKNVDELRVQLSQLETKYKAVARKRVPDTGEDEAQIEGLKSLCKTVSHHIDLT
QSTLASREKDLKALRSALKTTEDKLAAAEQELEQLRAQHEAAQQKFNEATDAIFASFCRR
VKLQNIREYEDTRLARAEQMANRKKEFAKQITALKATLDFEKKTASGFADRVASLEQKHE
ELENEKEKQEKALEKLGKDLDRETKRRDELLAIVKEKQEAEAELAAEMKELQSKIRENAQ
HRAEAQKDLTNSRTRLDKLCARRHQHYKYCKVNGIPLPFASGGFKQVQDEEEVPAISTDV
SMSTSYTSIEGNSINTDVAQRLYAKEAEIELTFDELPEDLLDVPEEDRDAVSREFVDRMQ
KTQAELEHIAPNMRAVERLADVRERLQQSATSFQETLERSTKAADAFEEIRAERCRLFRD
AFDHVQNDIKTIYKALTESPSAPAGGTAYLSLENSDDPFLGGVKYNAMPPLKRFRDMEQL
SGGEKTVAALALLFALHSYKPAPFFILDEIDAALDNQNVNRVVRYIRRRTGAHFQCIVIS
LKDTFFSHAESLVGIYRDPKQQCSRTLTVDLTQYPEEHQA
Download sequence
Identical sequences F2UH03
XP_004991317.1.12839 PTSG_07521T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]