SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07540T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07540T0
Domain Number 1 Region: 282-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000132
Family EGF-type module 0.035
Further Details:      
 
Domain Number 2 Region: 371-430
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000168
Family EGF-type module 0.041
Further Details:      
 
Domain Number 3 Region: 193-251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000659
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  PTSG_07540T0
Domain Number - Region: 416-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.039
Further Details:      
 
Domain Number - Region: 466-614
Classification Level Classification E-value
Superfamily Aerolisin/ETX pore-forming domain 0.0165
Family ETX/MTX2 0.045
Further Details:      
 
Domain Number - Region: 332-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0293
Family EGF-type module 0.013
Further Details:      
 
Domain Number - Region: 153-207
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0479
Family EGF-type module 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07540T0
Sequence length 972
Comment | PTSG_07540 | Salpingoeca rosetta conserved hypothetical protein (973 aa)
Sequence
MRGGSVLTTLFAALAVVWLGLGDIEGVEAGRLRVYAKSAEGTVRAQVVNYDNGGGLDVRV
QDRFSFSFSGCSKQTRSFRLTKELYRSGPFGMSIYIGTSIFDFTLEYTPTNLCSTSYCDA
TSTTCSCRSDNSATCSCKSGYTYLDAQRCQERNICTNNVKGCDLSSTTCRKTGPGTAECD
CKAGYRRRTSTSCAAINPCSDNPNICGSNSQCSMTGPGTYRCTCEDGYSSSTADNKNCRP
IDRCELNTDTCDGNNTICEYLGPNRFKCTPCPDGHKATDDECKQINPCMDNEGICGDNAT
CEFAGPGKYACLCASGYEHDSPTDKCTPINFCEQTPGPCGDNSKCSPTGPGTYTCQCEQG
YESDDNAQTNCSPINRCDTNNGGCGSKSQCDHTGPGTRRCTCDAGYRSTSNDGANCVEID
PCVTDNGGCGDASTTLCTKTGPNERECSCRDGFTSETGRDCIWINPCVNEDYGGCLQATE
ICMNTGPNENKCDCRTGFQFDEETGHCQCGERPACPEFSACQDSSCVCEGGLRLVETDVG
DLACAPTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTSASPIVVITTPYTAAAG
TTTTTSTTTAGTTTGRDMQPQPTSTTSTSAVFTIAPPNRQRSSTSSAANPVVIGAGAGGA
LVGCALLIIVVVLFVRRRRRDHHDGHRDTTTSVPPSRAPTDGGAVPSSLSSMSTTNPLFV
GDAMMEPASMQPAWLPEEEATAFDLDPRNHYDNLYEDDVVDEADNYYESVQPADDQDRYL
TPGQSKLYAPAYRVPNVMDGGGPTQHTHDRDRGYEQPASTQQHYYDRPQPDDDSNNNSNS
NSSSHDHEHEYHHYDFVAAQPEYENPGAIYDIASDPVQVQGGQVMDDYAQLHVPFATNVA
TQREQGRRPQSNAVYDVASPSALLEQPTHHHQHHLYELGSDTGVDPAAHNGLPSTDQSDL
APVYDVASDSHA
Download sequence
Identical sequences PTSG_07540T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]