SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07575T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07575T0
Domain Number 1 Region: 274-332
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000959
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Weak hits

Sequence:  PTSG_07575T0
Domain Number - Region: 234-286
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000153
Family Complement control module/SCR domain 0.0085
Further Details:      
 
Domain Number - Region: 80-179
Classification Level Classification E-value
Superfamily Tropomyosin 0.00183
Family Tropomyosin 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07575T0
Sequence length 507
Comment | PTSG_07575 | Salpingoeca rosetta predicted protein (508 aa)
Sequence
MNATTATTISTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTEPVFRPKIVVEDGRFLIRL
DGGIDFDPLEVLAELQRLRDEVATLRASTNTRIDRVNARVTELDNATTSRTSGLAEQLST
TQDLVGTHDQKLEALEGEVEDNAVTAGELGDALDAVEHRVTAAERNQTAASSRVDDIERD
IMYLPGVLACAEGRNLYDASEDECVPAKTIACNKDLLEMAIASSHSEVVETSCGTIFGGV
GCLVQCSLGYEASPNSAIAVCQADRSFSVPDLDCEIVDCGAPPNPHGVTYQCDAHTYGSS
CHVTSCPFLVGGDSSLTCGADGQWRGTPPECSQFRPWVLDGNQYRLPKEEEGPFTSSSCP
SYFVGGNAYSSGGITFITGPFKQSNNRFAVVPNGAQVKLVPSKPVQQMHFLVSGGRGTGF
SFYVRFYYTDGNTYQTGTGSIAWDCQAGASGASGLSITHLGGYGNYGCCDQWYRLYAVPN
SSSKELMAVSFHWSGGGTDIFGITAIV
Download sequence
Identical sequences F2UH57
PTSG_07575T0 XP_004991371.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]