SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07636T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_07636T0
Domain Number - Region: 86-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000105
Family APC10-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07636T0
Sequence length 1498
Comment | PTSG_07636 | Salpingoeca rosetta hypothetical protein (1499 aa)
Sequence
MEPSSLMRETVDGDLASTVDDTLTFDEWRDFVRGHDYDVTHVPPSGDHLRANYASDDCGA
QMVAASPDIKKASAVLSSNRDSYLMVPCKADTWFIVELCDHVLLQQITIANFELFSSIAK
TVEVSASEHYPTEEWEHIGTLHLKDVRSIQKFQVESQQFAKFVRFHVTEHYGSEFYCPLS
VVTCRGVTMIQEFNFLRAQGEPNGLDENNADGASSQQTNAAHTSSLARTVMQGARLVGQL
LWASDDDRMRGSSPPAMVVEVDSAYDDDEEEEEEKGEVQQPQQQPQQQQHHQQHHQQHHQ
QHQQEEEAHNAGGASSTASDSRSMEDVGASTPMNTDMPADVKPTSDTHIDTHSAVDGRDG
NASERQQEQQRQQQGQQHDQPDHMRAAREQEETAGRGDGADGRGMHVDGTDHTQGSSTQE
EGCLPTSALNDTKPSSLEAASHEATQAENESTATPPSSSSSSSSSTSAGATDDARDPQQQ
QQQQQRRGVGFIVSVDGENEDDEGDMHKHGNHAAADDDDDDGATGAGDSAEKHNQAVPTT
TPDHEDGTTSAPNQSPSPSPAPPPNTAGDTRDARDSSLIRGGAETRAGSDGGGGDGEGGN
AEQVAPSSGRVADAADGGHSSAGEGDHVPPPSTHAADTVPAAGQGEDDEDTVDANPDDEF
AIRARDVVAASARIADDSTDGGRGSAAVAAGTKAQAGGDSNGGPDSAENAGTPARSPAPR
SSSSSSSTVSSKDEAPAQRSREPAELDGRDEDAVDDALAAAPHSQDTTTDPASGDAAAIE
GDGDGGGGGDHSGAGEGRASGGLSKVAARLVSLSQGKPHASAQAEGGDENTPQHEQHQQH
KEGAGAPSSPKAPSPEQEHVGSNSVEATADASPSTASSRPSPPVQSSSLSDASGSVVRGD
TPTRAVPDTSTPSEEDASSPDADTNPDGIHPHREQQQQPPQVSAPVSADGDDAVGALSSS
RQQPSDAVAQDTAGRASSGDAAAPHASRPPQHTRSSPQRTATATAALTSSSSPLRPTRTL
PCNACAAVRWGCLPKAGRAGRPQHTTTTTATPTTTTTDAAAHDGASDGEQRNGSGDTRAS
ASTNDDESSSDGTHESAGRSAASPSPQGRTGARGSEQLWWWWWQCPQLNMTNTVNMISVG
MARSSAQCRTDRCTMAGGLPTVPVQLHRRHKAPDAATTTTSTTTNNGTSNSSRDDQRSGR
SSRSSDEQPVAVGGSVHASAATSADNATAHANATHTTDQTHRNATSPAPNVHKTANTADT
TTTAAPTPASGGGAGAPTAGVGSFTSRSKTASFMTHLRARIAELERDTSLTDTYLNQLSQ
RTRRLEQDLTSAVRTLRDDASSTRHDVMSLHADVLLLRADVHRLESLVVVATALALCALL
LVCTVAVGGAVVYLRVARPSHASSAAPTAVRGGGGGATTVSTAAYGDGHCNNGGQSDANL
NGGGDRHRALGRGGAVGVADVGVAATTPPSLRKRKVHSNGSTGLRIHTPPRPRHAKRT
Download sequence
Identical sequences F2UHC0
PTSG_07636T0 XP_004991433.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]