SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07753T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_07753T0
Domain Number - Region: 78-212
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00726
Family NagZ-like 0.016
Further Details:      
 
Domain Number - Region: 425-485
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00848
Family TNF receptor-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07753T0
Sequence length 858
Comment | PTSG_07753 | Salpingoeca rosetta predicted protein (859 aa)
Sequence
MAQTSMTREAAVEYGYQLLLLLQTPKLNFTAQSQRYPSSDCNEPCTGAATEMCGAANRMN
IIRANCYGTPVPTATKELPFCNTSLSIGARLDDLIGRLSLQEMAGLIGPDPVTSPCAFLD
YGVKRLDIPPYLHLVETNTAVASACITSQDKCATTFIGSNGLGAAVNRVISTEMRAFNNL
NWHRGGSVLQKIGLTGLKHFGAHSVETTAWHSTGTSPPLTSGTPREYPPLPDRASCFPTS
VCEEPFIETIPPTLTTDRLCSCDTLTCNKLVTQLFEEMVCADPTDEQLDVVLDVCCSGQG
EDGICDTICQMDAYEARRSCPGCTDTCECSAGFILVYDADSADCRPCDSVTEFSPSIGGS
KCEPIEECERGQEEVSAPTRSSDRVRRDCPAGTIDSDSDGSTGCQLCPAGHYTEAGSHGS
CSSFTCRAGTHHHHDSDPTTTCMDVTECASGHEEVQAMTLLISDRVCDECTEGTHKAVSG
QGVPCLPVTTCDAGEEETAEPTPTSDRPVDGQAEACRPVTQFGAYEEEIRKLTRQHDRLC
RKCVQDTRVPVSRCAGSGAFSRMAASKCEFGTFQSQAPTLDSDRECAAGGGRGAGHLKLL
HPIALMLKGTLDCLSTLHFIHILQLFCVLTTLTFDRQRRRRRPHRKMLSQSNEALKRIGT
IAATTVTCTWLALASDIGISATISPLIYVDKCVQLTCTVTTTPPRPRPATAHPSSWCRFL
PRSPAPTAIKSEHICRDACTGMVGSPSTTTAHGRMGSGRSPTLAGTCGGSRDPKRTRTGA
PQTRETCSNLSPEDTRAREVDKDTHVVVNEKTLQAPFETKLKLLSGIAAEFAGMMRSKTD
EETRLRKHAAGTQTSSRS
Download sequence
Identical sequences PTSG_07753T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]