SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07770T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07770T0
Domain Number 1 Region: 2564-2736
Classification Level Classification E-value
Superfamily vWA-like 7.19e-29
Family Integrin A (or I) domain 0.0023
Further Details:      
 
Domain Number 2 Region: 2781-2965
Classification Level Classification E-value
Superfamily vWA-like 2.05e-26
Family Integrin A (or I) domain 0.0018
Further Details:      
 
Domain Number 3 Region: 4096-4265
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000585
Family Laminin G-like module 0.029
Further Details:      
 
Domain Number 4 Region: 3809-3847
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000229
Family EGF-type module 0.0067
Further Details:      
 
Domain Number 5 Region: 3771-3815
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000264
Family EGF-type module 0.013
Further Details:      
 
Domain Number 6 Region: 3727-3769
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000469
Family EGF-type module 0.013
Further Details:      
 
Weak hits

Sequence:  PTSG_07770T0
Domain Number - Region: 3957-4071
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0333
Family Clostridium neurotoxins, the second last domain 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07770T0
Sequence length 4273
Comment | PTSG_07770 | Salpingoeca rosetta NOTCH2 (4274 aa)
Sequence
MGTLAQTTTVADTMQPTTADTSNTTSSDTTTPEPTTDTAEMTTGELTTTDDVGDPATSTA
PMTTINAVSSSTSTTAPIETTTGTDLTTTDTLEETTADTSTSTSTSTSTSTSTSTSTSSS
SSTSAIDTTSADLTTTEGLEETTTDTSTSSSTSTSTSTSTSTSTSTSTSTSTSTSSSSSS
STSAIDTTSADLTTTEGLEDTTTDTSTSTSTSTSTSTSTSTSSSTSTSTSTSTSTSTSTS
TSTSSSTSTSTSSSSSSSTSAIDTTTADLTTTEGLEETTTDTSTSSSTSTSTSTSTSTSS
ADLTTTEGLEDTTTDTSTSTSTSTSTSTSTSTSSSTSTSTSTSTSTSTSTSTSTSSSTST
STSSSSSSSTSAIDTTTADLTTTEGLEETTTDTSTSSSTSTSTSTSTSTSSSTSTSTSTS
SSSSSTSAIDTTTADLTTTEELEETTTDTSTSTSTSTSTSTSSFSSSSVKTTADLTTTND
LETTTQELLETTTDTSTSTSTSSSTSTSTSTSTSSSSTSGVTTDDLTTTEALEETTTDTS
TSTSTSSSTSTSSSTSSSTSTSTSTSSSVETTAALPTTGDVETTAQDLQETTTDTSTSTS
TSSSTSSSSSTSSSSSTSTLTSTSSTTDVLPTTPLAVTTEGMPETTTDTSTSTSTSTSTS
TSTSTSTSTSTSTSTSSSSSTSSSSSTSTSTTTTSTIDLPTTLLLVETTDRLPDTTTDTS
TSTSTSISSSTSTSTSSSSSTSTSTSTSSSSSSSSSSAVLPDTTFAIPTTDVGLEPTTQD
TVTSTSTSTSTSTSTSTSTSTSTSTFTSTSSSSSSSTTNSQVAVPESTFVVPTTDIGGEL
TTQDVTSTSTSSSTSTSSSTSTSSTASTTTTTMPAVDTTFQDFDATTHADLPTTDALPGA
AERGAQATLEEDWLSTPDWTTTAEGTKAPSAVATTMAGDDTTVGEQVTVDSLGSTVDALP
TTADHVADATATATAGTTTTTTTGLPDTTAWEETSADVDVVTTDVPATANPRAGATTEPS
TPATAAAAPTSQDWEATTADDAVASTADVVSSSSDLTTTTATTTTTTTTTADVQITSDAG
AATTEDDEQLLTTADGVLSSPAAPPTAGATARVATTTQDDELVSTGASETTDDAGGAAST
IDLNDARTVSTLRPAGAEPLATTTTATTTAQPVTSTMMETSTALPDTTTGEDAAASTVDE
TTTDTLEDTTSEAASTTAHAEDTTADVTTSAQDAPLTTTDAGTATTLPTTATAEATTADE
TTTNGAIETTTAEAVATTTDGLPASTAGASTTTVATTETATTAAAVDTTTDDDMTTRDAI
DTTADDFTTTAAAATTTATTATSTTTPVVETTTLDDVATTTSDWDTTVDAEGSLSFSAAT
TTTQAPSVPTTHDDPTTHDDPTTRAEAETTTDDLVTTTTLTTSTTIPTTAVDGTTRDDAT
TWDEGATTTDGSVDTSAPSTATAIPATTRAEQTTHDEAALTTTDDVQPTTDDGLTTTTTT
TTMTTTTSSTASTTTSTTAADATIEVATTLDEQTTREAVETTDAVTTTTTTITTTVADTT
RAEEEVTTHDGGDPDAETTADANVATEESSTAVPPTTTVEETATTDGADVVDTTIDMDVP
TTATEPVTGSARKRATTTTVPAAFTTDGSLMTTAEPMDTTTDDMTSTSTTTTTSTPVPTT
EEQLPSTDNADDLLFTSTDQGVTSTSTSTSTSTPVPTTEEQLPSTDNADDLLFTSTDQGV
TSTSTSTSTSTPVPTTEEQLPSTDNAEDLLFTSTDQGVTSTSTSTSTSTPVPTTEEQLPS
TDNSDELLTSTDMGMDTTPATTTTTTTTTTTTTTTAATTEDVAPTSDDSASFMSTADNAE
VLSTTNDVTSTSSSTSSSTSSTPTTIVPTTQPLVASTEDAAAFASTTDDTATTSTSTAPQ
VPTTEALVASTDDAGGLLPTTQDVTSTGTSTSTSTSTSTSTSTSSSSSSSSSQVPTTDAV
VPSTDEQLLMSTSDDAAVLSTTNDDVTSTSTSTSTSSSSSSSSSSSSSASSTVLPTTQPE
MASTDDSELLSTTEDLTTTTTTTTTTTTTTSTQMPTTQPAFASTDDMELLATTTDSITST
STSTSTSTSTSSSSSSSTVLPTTQPLLASTDNGELLATTTDEVTSTSTSPSSSSSSSSST
STSFAPRTTEGLLASTDGGELLATTTDEMTSTPTSTSISTSTSSSTSSTTTILPTTQPMF
ASTDEEQLLATTTDEVTSTSTSTSTSTSSSSSSSSSSTVLPTTQPFIASTDEAGMLSTTN
DQEMSSASTSTTTTSSSSSPVPPTTEQVFASTDEGVLLSTTTDVTSTSTTTTTTSTSSVA
PPTTELFVASTDDGGLLATTTDEVTSTTPSMSSSSSSSVAPPTTDALFASTDDGGLLATT
TDEAASSSTTTSTSTSSSTSTSTLSSTSSSSSSSSVVLPTTQPVFASTDDGQLLATTADI
GTSSTSTSTSTSSKPIATTQDVVRTTDDGLLVPTTDEGLVTSTSSTSSSSTSTAPPVATT
DVGFEHTTEEDLLPTTADITSTSSSTSTSFVPDAVICVNDTVLYRDVVLVLDSSASLHQS
GWADVTDFASAFLEAFPSDTTHARVAVVVFSTRASLVADFDDYLGDLRGLASVVETLPFE
NGATATDRALRFVRQNLISSVDAGRRSNVGSVVITVTDGEPSAFQEDVQQRVDELVAVGA
QLYAVGAGDLVSDSTLNLLGPDGVFRVESTRWLFDLLADNEFDPILCGAAGPSTLSTSSP
LKSVSSLPFTTEAITSSAVVPLCASDPSADVLYQDVVLVLDSSASLLEEGWAAVAEFGAL
FLEAFPSDTTHARVAVVVFSTRASLVADFDDYLGDLRGLASVVETLPFENGATATDRALK
FVRERLVTATGVGRRSNVGSVVITVTDGEPSALQEDVQQRVDELVAVGAQLYAVGAGDLV
SDSTLNLLGPDGVHHVDDVNHLQDLVFNSDFDAMLCGVVDVGTSTTTTTTTISSTSTSTS
TSSSTSSYTSTSTSTSSSTSSYTSTSTSTSSSTSSYTSTFSSTSSSSSSSTFSSTSSSTS
SSTSSTTTTDAWPTSAPSTSSSSSTSSSTSSSVSTTTTTITTGVPGSTSSSSSTSSSTSS
STSSSLSTATQGDAPSTSSSSSSSTSSSTSSTTETPSFPSTSSSSSSSTSSTFTPPTTSS
SSSTSSSTSTTLSTSTSSSTSTSTSGVISFSASSTSTSTSSSSSTSSSSSTSLSTSTSTS
SSTSTSQTTSTSSSTTSSTSSSTSSSISSSTSSTTSSSTSSSTSTSTSSSSSSSTTTSTS
TSTTSSSSTSTSTSTSTSTSTSSSSSSSSSSSTSTSTSTSSSSSTTTSTSTSSSSSTSTS
TSSSSSSSTSTSTSTSSSSSTTTSTSTSTSTSTSTSTSVTTTTPELSFEAADGPASDSWQ
LDTNARVVDVSGGLCTLVQCNATDSTLLPPGDGTAALLFSGAGQAQRSVRVVFDGRTLVS
VRFALGWPLGAPLPDSLWVTVAVVSHTSTAGPVTALPSQQRIRPMELPLLHEGSMAEAEA
LLVVDAPDGAGVTSVDLALTLATNATSPSDRLLFDNVAVSVSSFTYDTLVDLNGPAPGLD
AEAAYRRGETPSFVCPYARVFDLGTGRPTTLLLQLDDGATQEQVLSASRVPGSSLTYFEG
VLLITADSTPAYAGALRTASFLDTDVDGTNVQLLDVGVSLTPVSAPAAVHLRVLPECSLD
PDCVVPNACDASPCANGGTCIANATDPTLFTCNCTSAFEGPTCEMPRDTDCEVYADACLN
GGTCVNLAGLDNYTCACRPGFEGDDCGVNIDECDTMPCANGGTCYDGENRRYCLCPLGFD
GESCELELCEPVNCDEDGQICIPDDNVVTTDRDGNIIFNPDIDSSPCGTFKSCQEGVCCF
APEFCTLNSTVLALLTNETVTAAAVPAPQGHGVYDLATVGAVSTVDLVGNVDGYLLRRQG
TLYITFRPASASASGELLRLQMTSSDVLLSVLVSTYILTVRVEDTASAQLYDEVASSLED
RWYMLMVVVNDTRVDVHLNKQLFDSFDIAQPLPAGADGDAAFTLGRRSSSSLAAYVYAPS
ARFVNGGAAQRDLAPLDLLGMGDGRGGLSAVNGVFTFTANESQYLQFDDPPLVTDVLTIV
ATVEQEANNNGYLLAKHASDDDRRLYSLYYSATRQSICVYYSDASKAVRSRCLAYVNDGG
RHELVVSMTASTIMLSVDGTVTGMLDVIDPLVDAAGTLYAGRRFGASSPPFAFEGTMHEL
RVHYSGSSDPSSF
Download sequence
Identical sequences PTSG_07770T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]