SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07814T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07814T0
Domain Number 1 Region: 2000-2190
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 5.23e-22
Family Integrin alpha N-terminal domain 0.0048
Further Details:      
 
Domain Number 2 Region: 1888-2031
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 3.53e-17
Family Integrin alpha N-terminal domain 0.0034
Further Details:      
 
Domain Number 3 Region: 90-395
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 2.09e-16
Family Integrin alpha N-terminal domain 0.0055
Further Details:      
 
Domain Number 4 Region: 1151-1287
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000121
Family C-type lectin domain 0.0057
Further Details:      
 
Weak hits

Sequence:  PTSG_07814T0
Domain Number - Region: 573-650
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00641
Family Integrin alpha N-terminal domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_07814T0
Sequence length 2247
Comment | PTSG_07814 | Salpingoeca rosetta predicted protein (2248 aa)
Sequence
MMRVARALAAALLLLLGVLASLSSPSHAQSILNNPSFEGGGPVASLRLSIPDWAVDGLGG
YYTPSTAHYPASSFMVDASSGQTVLASPADGTNVAVIMTGAELSQEVVWSPGQGTGPTPD
YYVDFQCAVGLKLGSLETGTMHVRVFAVQGSGGGAEDMLIAEASLQPALSTAGQFQTLAV
SGFLAADVANTTTAIRFTATHTSESALSQLDADNIRLTLTAVPDTGDVSDALDQWNTAAG
PCFYPFCVPTFDDASEVLLFTAGNVLSADTTDINNDGLVDVVIGVGQTKHVVLHQGLGGR
RFAARIMGTTRGVPSQVIFAHIDNNAYADVLVAMHDIGRITWFRSRIDGFSFSFQERFVA
DIPGLTAFTAGDVDGDGAPDVVALAQGTLYWLRNRRADPQFEPARVLAAQAQVLSPITDI
SSVRVPGAATAHVAAATSRGDVFLLVGGSSLLSMPASVVPVISSANSGDVAESPPLSAPL
LLSVVASPTAVYLAVCSPATARTRLFKITEEGALRTVTPRRDWVLPLAGFRPSIIQLAFK
GERAASASSGDSLDASDDLVSLSAVVGEHAVVTWFDVLRTTGEPPSTAFALDMQQAISTV
LLRDVDGDGQLDAVLAADRDFGPSVRFGDCCTADSLLAFSYNTTNPSFELQPSSPLGPPP
FWLTTGTVSTVTFDGPASGYARTSTPVGDSSILLPYPAHGSAFVRLELLGILEQTLEGLV
IADSTAYALTVAVGWPLQATSVPTVIVELVTADTRQPLCSVTYNQADLPTGPGEWVDVLC
VGSISTASVSDSSTLIGQPLMLSIIGVGVGTVDVDNVRVSAHTEDFLSLVGSGPFFGHRS
SAPEGPFTTAAPTTTTTTTTTTAAAGGSSSTTTTTGAGGPGTTTSAGATTSTTTTTTTTT
TTRGPPRFKRISVGNNDFESPVVSLGSWDASATDWALRGPAGVYRPTIIQFRQHDAEAWG
AQTLFLGPKARASHVLPGVQIDPAYDYQLRFMLAWRLDFRQFPTLQISLRDGGNNVAVAR
TITAVDMTLLGPIGRFYPITLNLSPAQGFVPGIEIVFAVVSGVGQANIDHVVLLRGEKGE
SFDEYMSTTTLSTTTTTTTTTTTTTSSFTTVSSTSTSTSTTSSTSSSSSSSTSTSSSTST
SSSSSTSSSSSTSSSTTTDFFGRGHEAWYEFGSKLFRVFPSKAQFQQAEVSCLLSGGVLA
VVSAPEELDFLLDLALHVTRNRELWVGARFSADAGLRWVLQNGLSADQLPFEGALPSSFD
GDKCLLFNSRDRRGNVQGELSVVECDAYRDVVTTPGRSEWTPVDLPGGYNDDALQHDVPA
QVEFFTESLPFGLYRIFLHDMIGPEGTRSLAIDMTHSHGVDQLLSSQVGDSTERRRIELT
LDPVFLSARPSQGVRLAASNMGTFTIDAIEFRVVPSQVDFSAEQLTPGFYRVYLHDLIGP
DGVTFLSITLNHAGGSEQFISSQVWDEQELRMIELTFDPVAFTGDAGQGVRLEASNMGLF
TIDAIEFVLCGNTPPPSSSTTGQLWQADAYKVTGRDVSEGNRPISDTDLDTLFFTGSRGR
RSTNSVEYRVPVPAGFEYRVLILVAESCTACSRVFDVEINGLPYEFGVDVLNEVGPDRAL
VLEYPNVRRRNGNIRVALVQRDVDGEQPIINALAIEAVTRISSDTTTSTSSAFSTISSTS
TSTASDTYTDSRGLVWQPDEGFYTNGARFQFETPIANTIEDTLYYTERAGVDGYLRYDFP
VTPGRTYTLVLLFADICPCTNGVGARVFDISIESTVVQADLDLVATAGWATAYTRVFETF
VADNTLTPIVVQLHIHLHIILIFILLVILLLHINVDVCRNNYACLAFLFLFDIHIYLDVV
LLLDLVLLIIIHLDVIIVLILVIHVLILVHVDHNDTSGYRTRAIDVNHDDMVDVVVTEEG
SGRVSVYTQAANGDFSLYFTTDAVAGARGVAVADLDGDGYDDVVAGGTDTLILLTNLAGS
AGDGGRGFNATVIPAVVAGVHEVLLVDVTGDGQPDIVASERTADRVVLFATQRASGAGGV
VVGEPVRMTGISAPLGIAAGDVTGDASVDIVAAARDSGAIVVLTSPTGNLIADTQRFTAF
SVAGRARDVEVVDVDGDGVNEIAVADSDSNVVVVGRRTGVSGGVPTFEMGTVASGLAGPF
TVIAGDYNGDCRPDILVAERSGSQVTLLTNTGVDGDTGLPVFTSLTVLTGVSGATGVAFI
DTNGDGWLDIVGSSDSSGVVALPANCQ
Download sequence
Identical sequences F2UGE7
PTSG_07814T0 XP_004991618.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]