SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07827T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07827T0
Domain Number 1 Region: 793-894
Classification Level Classification E-value
Superfamily Cadherin-like 2.14e-17
Family Cadherin 0.0029
Further Details:      
 
Domain Number 2 Region: 1718-1804
Classification Level Classification E-value
Superfamily SH2 domain 3.67e-16
Family SH2 domain 0.001
Further Details:      
 
Domain Number 3 Region: 890-994
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000003
Family Cadherin 0.0035
Further Details:      
 
Domain Number 4 Region: 1550-1587
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000141
Family EGF-type module 0.024
Further Details:      
 
Weak hits

Sequence:  PTSG_07827T0
Domain Number - Region: 1106-1196
Classification Level Classification E-value
Superfamily Cadherin-like 0.0007
Family Cadherin 0.0057
Further Details:      
 
Domain Number - Region: 1010-1094
Classification Level Classification E-value
Superfamily Cadherin-like 0.00214
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 683-777
Classification Level Classification E-value
Superfamily Cadherin-like 0.0051
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 1350-1430
Classification Level Classification E-value
Superfamily Cadherin-like 0.00671
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 1443-1535
Classification Level Classification E-value
Superfamily Cadherin-like 0.00728
Family Cadherin 0.01
Further Details:      
 
Domain Number - Region: 501-525
Classification Level Classification E-value
Superfamily EGF/Laminin 0.021
Family EGF-type module 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07827T0
Sequence length 1886
Comment | PTSG_07827 | Salpingoeca rosetta conserved hypothetical protein (1887 aa)
Sequence
MLARTALALFVATVVVTLAASTTAVQVTISPNPVSTTFRVNEGFSQVFELKLDEPIICQG
DAERECNVVIKLTNSHPEELALDSCHVKWLPHQWTESRFITVRAVEDFIDDGEKDFTIVT
EPIDSASLYYNGFDLPDLSLETAPRPSAVCRATGDPHYRSFDGHAFHIYAPGRVIFYKST
VRRFEVQTDMYSFSRPAVHCAIAAREGNDIVVISLCEDGHTVRYRRSCGSTQCDSGSYPK
VGITGSSNPRYVIQFASGARVDAQVNYWSAIRRRYINVYVTAPGVDYGNTVGVCGNNNGN
PNDDMDIGYNRWIYNLDLLYESQRPTENLFSWYPSGISDDGPTLPPFAEECDYQDPPFVR
PILNNPDVEDITGILKKSIPADEEDAEGIDFDGSVIAEQLPQEWTQQEAEAECNKLNAHP
VAVRCLHLFPQFPMDAFLAQCVEDLIETGGDPDFLAVAVDALEDQCADFGNRDLDTWEKD
EDGNPMEPDGELQTVLCPNGCSGHGQCVKSRCVCDEFFTSEDCSLDQRQPPSLDRADPPL
CDTRGRFGCPAEISVLGEGFWKSAGLACRFNGDVVTEALFLSALEVRCRVPTVEQSGSNQ
VTQTIEVSMDGENWSEPSASFTWYDSVCQVCTAHGCEPNADACTIDGVCYLASQTNAADE
NICQTCQPAVSSSDWSFDYTNGAECGPKFTSTMYTGRIVGSASQGDELVTVDAMNPLVAG
DASNTVTYSIRGTNHILAVDQAGRVTLTQDFEVTEDVLHNQAFESLVHVVATDSAGNSVE
VPLYIELQLTNSQPLFAETQYVFTVAESAAVGSVVGRVTADDTNTDGDWGNVVYSWAHVE
ANTGGVFLVDPTTGDITVGAALDFESKAAYSMRLGARDGGGQSHSTDVVINIEDVNEAPE
DMQLSPASVPENSDVGTAVGTVSVTDPDAGDEHTLALDAGDAANFALVGAELRTARVFDF
ENEEDRSLSVTVTATDKAGNAITRTFAVEVTNVNEAPTNLRLVDQPEGTTTILVPEAAPI
DRAVADIDVDDVDSDIVGCTLTQTDGSNFVMQNRRIILVQALDYEADMEHMVEIVCADDQ
GAASQPLVITVQVVNNNDGAENVALTLVQDPLPENTATGTVIGAISAEDHDANSGPLSFS
LPADVAGILSLGAPACQPENGVMKCSVAVTLESELNYEATQDGTFAFVVKVVDDQGMLNG
VELVIPLENSNDPITGVAWANGGGSVYESAQPGDIVGELVVADDDLAQTYTVTLESHADV
FEVVDSNSAEDQRRRRREAEQEQLSNPQAPSSGSANTNFAATIAVRDASSLTAGQTVSLS
VSITDASDEPLTATFTIDIAVEKEPLSIRFEDGTHFAGVQENVAAGTVVGTFVLRGVPAG
GNPSIAIVPSANTPTPFRISGDQLLVDGAIDYELHQAFHVDVSVSFPNLPSTAESIEQER
FTVYVTNVDEPIVFTNIPDTPVLVNTDASVGSTVFRFAAVDPELHAVTFRLTHDDTNGLF
RVTRDGALQLARMPSTTNTAHGVHGVEVEAVLQNDPSSAPAVKASLEVRLHDDCDGQTCS
GRGRCVDGFRTFTCDCRFGFSGDVCERAQTTSTTTTTTSTTTTASTTSAPATDENGNPIV
TNLGSQRDASASLASSTIAGIAVGIVALLVLVALVVVLVVRRRRTEDLYESSTKALQSVR
AMDNPTFVAPQYGVQGEGGEAQYTYSMAFQPGMSNPLYAWYQPDYTRQETTNELLSAPQG
SFIVRDSKATPGWHMIGVRTEEAVIHEKIRRTDDGFYELVPANNRPQPAFPDLPSLVGYY
GSANSDAGFTLNVSSLDNPMYAQSSMGAASSSDYEAVGPTVWTRDAEAPVVPLKEREKQA
VQQFASVDDGDLYCNTEEAKAALADA
Download sequence
Identical sequences F2UGG0
XP_004991631.1.12839 PTSG_07827T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]