SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07903T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07903T0
Domain Number 1 Region: 162-228,288-355
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 5.08e-17
Family Asparaginyl hydroxylase-like 0.033
Further Details:      
 
Domain Number 2 Region: 808-872
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000375
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 985-1052
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000917
Family Complement control module/SCR domain 0.0025
Further Details:      
 
Domain Number 4 Region: 925-996
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000486
Family Complement control module/SCR domain 0.0045
Further Details:      
 
Domain Number 5 Region: 873-934
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000139
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1043-1101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000737
Family Complement control module/SCR domain 0.0026
Further Details:      
 
Weak hits

Sequence:  PTSG_07903T0
Domain Number - Region: 1185-1246
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00848
Family Complement control module/SCR domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07903T0
Sequence length 3219
Comment | PTSG_07903 | Salpingoeca rosetta conserved hypothetical protein (3220 aa)
Sequence
MNSGHLHLRHGGRALRARARVALALLAVVVAALSVSGQQQQYEAPQAWANDISSTTPSQL
SFGDFFSVDAATFFSTIYQQDTFVDNTVRQAQLLPALDQVVAPLGDVDALCRAFENQDKQ
TGGFHMKEQGETRQVSSCKQMEDELAAGAGLLIRYEDLVDFPAEDNVKQLQEGVRDVFGT
ESTVHLYHATQNESRALMPHTDPYDVLVIQLHGSKRWTTCIPDAYATSGSDDTTEDHSDS
HPDEKAASSSNGQQQHGHGEAETIKQFNPAQLGQLQEIRRQKQEGCTRYEDRDLRGMRCN
EFTLRAGDTMYMPKGIIHYAVSGAEGSSHLTISLERRGLAWADALVYAAHAGADIVDNTA
FTKHWQRALQSLISDYRGVQLLEAMPSWHLNTGALCPSHDATKEKDDGTSEEGTTGGEEG
EELTAFIGSFMAQCEAMQPHVLESYTTANDLEAFLNPDGIEALADRVCSEDTARAVVSEL
CAQGKMPVDVTSPFFRIQALRERRRRNTVRASYTCDSNCNTGCDGQSCSNCDDNCNSGCD
DDCNECDASCDGCNGQSCTGSCDESCDRCLGSCDTSCDEVTGCMYYCDQCVNLPYDYYYN
YYYDYRRLCYENCHVGYNCQPTSCDDSCNSNCNADCNAGCDSSCTPTGCNFNCDSSCDGP
CDAGCDDSCDAGCDTCVGISCDDSCDGSCSCNAGYAGSGMSCSACNTPYYSPSAGASSCT
PCGSCSSGQYRANCGGTSGGTCTSCASCPAGQERRGCSGTSPGGCANCNSGTYKTTQGTH
SCSACGSCSAGYYLSGCGGTSAGSCVGIACTTPPTVNHASFTTSNSRKYPSTATYTCATG
YLIESNDKLSCKTDGSWSGVTPHCIGVPCQELALDHGSVSPSGVIRHPNTASFSCEVGYE
LTDTAPARCQADGTWSAVPSCVGRLCESLAIPNHASVSYSNNRLYPTTATYTCDPGYEIS
TGDAQRQCIASTGAFGGTEATCIGITCNTLTPPDHGSITSITNNGRYPAQAAYACDPGYE
PVGASTTIDCQTDASWSPEPPTCRGVLCADPNIANAQTTRSSERYPADATVACDPGHGMA
GPVELTCSTAGTWGELPTCTQCPVDTYPPTPTEACVSCPAGTSTNGQAGANQCECIPGYE
PSGDGLTCVPCRDNFFKGECGNAMCEPCAAGYQTENSDFTQCVGIEFGDPTSTESVRYPA
VIPYVCELGFHAVDDLDTITCNTDGTWTQTCNTDGTWTQIPSCTYTCVCMIVEGEECDDG
DSMGGDGCSADCKLEDTHACIEQGKDCVYCNFTSRPEPLALACDDPDFAFKVDAWASIAG
SADVLDHEHCGSPTFTYMSTNHTAGHLPNCYKRLFDFHAVFNDGKVDEIVLGRLTVTDNN
TPWFATVPERNVSAECHVVPPVANLTAPDVCIPDGGARVTATQTRVDGRCPYEYTLQRTW
VADDGCGNTNSTQQVVSVFDSTAPVFDAELADQTLECGANVTRDVAAVMQRNARVQVTDN
CSPTLTMETEMLGLSLAQCGGTGDVRFRVTATDQCGLSSQQDVHIAIEDTQPPVGANVPA
SVTAECSAVPPLAPGVFAVDACGERRYDAVTAEERVDGACAHAYVLRRTFTFTDVCSNSI
TYVQNVTVRDTTGPRITRQPDPLRLECDGEDNEAVIQAWLDAHGGAEAEDKCSSADQITW
HHDYERVQSLFEQTCRDVVNVTFMAVDDCGQGTPVSAAIVLTDTRPPVFLEEAEDQMVTC
DVAVTMPAPRAYDNCTGEIEATYTDARMDGACPFQYGVVRTWVAVDGCGLNATTKHALTV
TDNIPPVISKPAVDTVVECVAENNTRALQMYLEAHGYAEAREPCGEVAWFYSDRSVQLDE
TSGPLASQDVNTTGGCSTTFTADVTFYAVDECNNVAPTSATFTIADRVGPVPVDTLPAVL
PASCDAVPGIPDLRMRDACSTKETVVSGFEERVDGRCPHTYDLKRTWLAEDDCLNTGTAQ
QTVEVSDTTGPRVVQAPTDLHVDCNGETDAQVQAWLDTHGNAMAVDNCDENSADLTWTHN
YEEVRRTLQRGCGNNNVTVTFTVRDLCGNPTRTTAQLIVADTTPPFFTRLPSHAQHQCDA
DTNEDVLQAFIEMNGGAVAADLCSATHDLAWTHSIEETTTCGMAANLTVRFTATDRCNNS
ASASAVIAFVDTEKPHIELYGDNPMVADYGYTWLDPSVRLATDRCHSEVTAQVSSQDNVN
TSAIGDYTVVYRVADPCGHVQTATRTVEVRDTEPPKIRGIGPQVLFIREGTVYVDEGATA
WDNYWPTVKLDGFVVVNGMEQTNLTASASIAGSESFTVTYRAVDGSGNEGVRHVRTVFVL
PPPDHGTATATATFVFDTALSVRRIEPAARTASGGAYYVVRAVVTSPTERVVPRRLRLQF
GGEIHGYAEEGTIARAEAGTGDDGHEVQVILGEQAGDGVRAAQELESVLATGATAVRVVS
FHGSTLRNPWFCGGVTLVDDILSREGRTVVDAQCDGCLCTYVARQPSAGDEFDVPRLEAS
MQWHVTVRALRAGEDIDLDHLKEKLVQFGVVPVRVQHGGGGAKDVATFVTRSRVPGGPNA
LWPARVSVVSVQPVVATQLVLEVSSGVRNVTLLSSLYAARIVPETVEFAPVLGRPARATL
TLTTHNDVTEFVLLTLADVGSSWMHRLVSVSYVAPTATATPSWPFNYTLCASDDAQPEEM
WSVWDTVTAALGLRTEVDYTVYSFGVNATCFGVATQQPLATDVTSQLLHVGNFSRVDLTT
DNSVDAAIHSSFQQQLMERLPFPASSMMFSMDSEGASQSLRRDSQLSITVTFTDPPEPTL
LAGGSPGYVIPDTRYSLQFEVDTTTDDLPTTTTSTTTTTTTTTAATTTITTTAAGAGGAG
NSTITNSTAITTTNSTSASNATAISTTLEDVVRSRALRALNDIGIPIVDISIDGTKVFAV
AVEFPASHLLDLNDHPYVKNATLRIPLTLNSALTAEDAVEVALQLVQSGIVAGEWNGYVF
TPTAVESPFTTTSTTTTTTTTTTTTTASTTTTAENSTTLSGPTTTAGRKFEASSSTAAAQ
WQIAAGVLGGLVLLGAFVAFVIVRRRTSVGASSGAAPSKQRETVSFTNPVYEDATAMQQD
DGLYDDVPDDAQQQEQLYDEPAALHDPGHAVFNPLYSAMSTDNMFEEDSDTEDVADHEAG
YLDVGADVDGADGGEEPTYAAADHDATGFDGFGGYDTDE
Download sequence
Identical sequences PTSG_07903T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]