SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07916T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07916T0
Domain Number 1 Region: 9-293
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 6.28e-55
Family Hypothetical protein HI1317 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07916T0
Sequence length 299
Comment | PTSG_07916 | Salpingoeca rosetta conserved hypothetical protein (300 aa)
Sequence
MPVKEVKDGKVVVLEREGDKVEVYTYGATVTRWQVAGEDILFLSDKAVLDGSKAIRGGIP
LVFPNFGAWECGPSHGFGRISTWTWDKDAAGAGDSEDGTTAVFVLEDNEQTRAMWNHKFR
LEYTVTLRKAQLECNLKIHNTSDESFDFTTLLHTYVRVPSIKAVTISPLKGSLKLDQLAD
RASVVEDQEPLTIAQNVDSIYVAVPQSLVIDNVATSRAPTPDDHSTALTRRKLTLDKANL
PDTVVWNPWVEKTKAMGDLDDSAYKQFVCVEAGHVAEKHTLAPGQHFHGGQTLTLEAYR
Download sequence
Identical sequences F2UGP7
XP_004991718.1.12839 PTSG_07916T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]