SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07926T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07926T0
Domain Number 1 Region: 923-1003
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000628
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_07926T0
Domain Number - Region: 435-467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00034
Family EGF-type module 0.035
Further Details:      
 
Domain Number - Region: 474-516
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 0.0464
Family Fibrinogen C-terminal domain-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07926T0
Sequence length 2923
Comment | PTSG_07926 | Salpingoeca rosetta epidermal growth factor (2924 aa)
Sequence
MHCRSPLVISTALLVTILALLSPPATAIVDIPRFFSEATPHSTLTQAGTYPSLKGDVVNS
NDAATLSMSAWMRASFSTNTGGTQLLWDVGSSVTGVSLVYTATNTVRATMCSAGQVILAL
EHNITASHLDAGANVDVVFSLDRRTDGVVNQTARLRVGDEEHVAVVDMTPLWSDSDATAF
LAPMSSNICTGSAGAVVDFADGQADLDLGLNIYTNWFYFDKPVTGDWYSTDRPRAQFGIP
PDLQYLEAGDYASINDESFNGKQNADVAPITFYVSVQLHPKYLNVDGSPPSPEVLIEIGG
HKVGLSLFYAAPHTLVLNKCGGSITIVYEVPEELTGTGDSTPFLDIMFGRDFSDNLFLVV
NGEAVPPVALGAANDIAGTDRSGVLQIVKNYCNGDGSYVNSRNEGVEFTSGTVDWNIGFS
LWVEEVYDPALTTDPSICQHGVILTKHSTGLAYCSCLPGFGGMRCDEEDLSTLPATCYES
EAPLTTGPQLLRPNPTASPIALYCDMDYWGGGNTMCGKFLRDNTVGKQFLDSDFGRVTSD
DAGSYDLSSLANSASTGYQASHDCRHLIEGREQGVFMNAGSDKDGSSMMDAVLFTTILPE
VLRNASSLLDVRQRPDALVGDVGCQAGVLDVFTADGEAATTLYPFDLTGAALVNTSTMWV
NYAKDGAIMSASATDSCMDTGENLVFWGFEDASGRVPNYRCSSQGVVTIGTYCGAASAPS
FRNNYLLVKATPPARDQVKALIGEADWTLRSFGAATSTPTAFRQQSATLEVVTNFLKVPV
GQSELIFTVGTASNGVTVAYAAPYNLQLFFCADSVTQQETFRLHDFHITGGQQSLALSLL
KQTNAYAVVLYVDFVPVAVTGAVVSNGQWAGSDSISFFSTASGVCGGTFRAPVSQRVNPL
RGLRMWTGKAFSNEDRCALTNACFNGGTCLNGWYDPPLCECAPGFTGPACADDIDECASP
SLNNCHKYADCENVPSTFTCRCKFGFTGNGTHCIDVTDPAITCPASVVSTDVFISWSSPN
ATDNVDDGVSVSCDTRPQTFPIGTTAVTCTATDAAGNQAQCSFDVTRLDAQPPVFPECPA
AMVVGTDRFSNKHTLSYAVPLAIDNHIPNVPVTCTPEPGEDVAIGTTSVTCVADDGRNRA
FCSFSITVEDQEPPLLSCPGDVQTTAPPGATSVNTIALPNPTALDAVDNDPSSLDVSCNA
TANQPFLVGYTVVECSAEDTSGNRATCTFEVVVRDETNPTVTCPANMGVATDAGMPTAVV
DTVSLLTASDNGRIARKACTWDASTPMPIGSNTVTCEVEDEFANSASCSFTVTVSDAEPP
VIVCSNNVTVSTEVSVADAAVTFGLPSVSDNSGRVASVSCDTPTQGRFGIGETIVRCSAR
DVAGNSASCALSISVMDTEPPALGCPPAMSVSTDAGLSTAAIEFAPTASDNSGMSVAINC
TVPSPADLGVGAYAVACSAADVSGNRATCTFDVVVFDEEPPVLSCPDSLQLKAPGNATSV
VANWTTVAAADNSGEPVTVTCSHNVGDALNVSVHHVDCSARDAYGNTDECAFVVTVQSDL
APTVTCPNDIVTQTSLGTSVAVVRWADAATAVDNADATLPTRCFPPAGRRFEIGAHFPYC
MAVDASSRVGYCSFKVTVLDVEPPVWECPDHITITTARNESYGVLNATTPTVSDNSGQVV
AQSCTHAHGDLLPFGDTTRRCEAADPSGNRAVCNTTITVVDAQPPSITFLQPDLVVETKF
RESYAVVVLPDPVAWDNVGVTRVSCNASSGAFAIGVHHVRCEAEDAAGNTNAGQYRVTVV
DVEPPVLTCPQSRVVVVRAGPGGDVDGDSAFYLSTTSPVTTTDVRTAPVIPTTPTAGMTM
PGLATMNVSASKTATSTAATSTTTTTTTTTESEPSAAAKSRSRRETSRTGEDNTLTLLLV
GTRELFTVYYGDNSDSDRQAASITISCVVVDGSPALGVGNVTRVQCSGVDASMNEASCSF
LIAVQTADAPELACDGPVTVVAVDGTAAPVSVQAPVQTRASEPLALSVAECVLPASSELP
VGEHDVVCFGKVVDLVPATSSAAPTTAAPASDDDDTAVGTSTNSDGDDDDDYDHVASAPT
TLPATSESFIGFCFSRVYVLEATPPDIECPSDVRVALPSTPLAQTAAVVLLDPAASDNEG
LAGVSCSEPNIASFPAGRHTVNCTAVDVYGNRATCGYTVTVIDEHPPVLECPTLVSTTVS
RLTEAAVAVDIGIIEARDNTGATFSTADSSSNGGGDGLVGDLVVACSAPAGGRFPVGQRT
EVTCTSTDAAGNTGTCAFAVEVGVDCIGQWSEWVCERCPNRVEHRAFQVSAFPVLGGAAC
PGEQQRACVDAEPCFFLRTSLVIGPVLDIDAAMGPLRADLVAFLTDVLPQIARVYGVEYD
EAMASMTIEGVFATSAPTPAVTISDTTDASISNSNSANTVDDDGAGDAAANGMRRRSSDD
DDDDGGSAGDDDGSIAEVVKDHLKVSVLIDAERTPALAMLDALEATMSDSSNTAAVAANE
VLAILRAGDPEDVFEDVSVAVFTSVTAQSVLETTSTTVLTTSNTPTTVGSRTETSLQAQV
PLIAGVCAAALILVVLIVGAVLVRLRKDEPIVLARRSPSTRRHRTSTLKRSDIIKIRGLH
HEEEAEYLEMNTLNNPLYDSKDGTNGSDGEEEEDLYDVVRAPNASDTSSDDDDDIMGKDM
FDFAGDEDEEDADDGFGLFGGTVERNDYSSANNMPVEEMSDDDLDAQVDMDMVAAFERRD
PLGLSANKNRNSSYGGDSGDDDDDYDDNDGDGDDEEDISGLFGFGQQDPIVADLMDGLMS
SEKMINHRKIQNLEEKNRELQRQLSMYTSQQPSPMRGASLTEGPVMTSTPVPVGVADDDK
NAPSRVSVERPATLWMDDGDGDGDDDVVPPGGVETSADEWLPR
Download sequence
Identical sequences F2UGQ8
PTSG_07926T0 XP_004991729.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]