SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07959T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07959T0
Domain Number 1 Region: 1124-1400
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.24e-73
Family Protein kinases, catalytic subunit 0.00000365
Further Details:      
 
Domain Number 2 Region: 147-305
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000667
Family Growth factor receptor domain 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_07959T0
Domain Number - Region: 281-361
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000324
Family Growth factor receptor domain 0.0079
Further Details:      
 
Domain Number - Region: 18-49
Classification Level Classification E-value
Superfamily EGF/Laminin 0.027
Family EGF-type module 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_07959T0
Sequence length 1670
Comment | PTSG_07959 | Salpingoeca rosetta conserved hypothetical protein (1671 aa)
Sequence
MATRFDSAMAQQDLCGTTGDCNAAGTCIDHGDFRYCECQPGNTGFACEFTACPQHSCNGR
GSCSNNVCSCMMPFIGSTCGQRQCQAGQYFDVMNDICESCPEGYYNPNPNSLFCFKAPFG
TQTVDATGTVVVTGAVNTIPCPAGFACPTASTASICDAGEFAKEGDGFCSLCPAGTASAI
IGESMCPPCTQGTYASGDGNTLCQTVPPGFYGTRGEDVDSDGIVDFVLMGATATLSCPPG
MACDGGIFAPCPAGSAPTTDQASCYECTPNTYAPTPMTDSCMPCPGDEYSLYNATACLPV
PAGYYRVGEGISVCPPASYCEGGDSVPEPCDPGAIPNTNRSSCDACLDGKYTPDNINCYP
CSLPSETSLDGVLQTVSEIGFVRDRDAQEIRDYILSDSALLGGTLVETIDLQLPEFAFYI
VPEGGADFTIDTGVSDPRSITFVGHLSYCHSSVYPTMSGPSSALDRVGLLDIDQFPQAST
SVSFNDNCFEANFLAGLAAGQTGFSGLLIELSFATTAPNNKGIYYPNSNSGIWFRDVGAR
YNNTDRSVVTAVDTQPPVFAYCPSDVTQSLAEYESAASVYWTDPFAEDNVGVVSLEGSHA
TGDKLFLRDSPVTVTYTAADAEDNRETCSFDVELEYPYWRTTERTTIVNQGQVFDESTRQ
HEYQSKITFTSLLAGGVGTTFPNFKLDSNRLRFTLTAQDRYQFRVNPSSDPVTLEMFALF
TRVYVASTTSSTTSIPPGTAGPIETTDAPFSSEVINALNAVVSDSFLRVSFEDARNLATN
EPIDIAPTWFQDEGTHFSSSTITLRGSATLPSYKDGMLFTGVTFEYSMPGLRPDVGLEPT
PFTPSTAWSTTTTTTATTTTPSAGAGTTTSWPPVGATTSSSPNGLSPSTSTSTSTSTSTS
TSTSTSTSTSTSTSTSTSTSTSTSTFSSTPSIDLLSLIEFQPVSGWAGLSRLGDYANDNT
GTAFLSVIGLDVEPPVIYCPQDQTINTDDGIDYATIDRMQLMATATDNSDNVTIISGLND
TYFPGEYTINMRAVDPYDNSAECSFLLRIVGSSNASGPGSNASTGAAVVGGAVAGLALLI
FVIMALVWRKRIRGLTRPKPYDFEERLRELAEHLRGEDGLIKPREIKREHVRQLDVLGAG
HWGEVAKGILEEHKQAGIPGFLVAIKMLKTDSIDSQDELMREAAFMAQLNNDFVVKLYGV
CTFGGPMMMVMEYCEHGSLQGHLRQTDMSVEQITQIMCDAASGLLYLSSRAVVHRDVASR
NVLLSSEWRGRIADFGMSRESEAESAYYHSRGGAVPVRWSAPEALEDHKFSEKSDVWSFG
ILCYEGFTKAELPYKGMSNQKVWVSVMDGFRLPRPDSCPENMYDLMRSCWMQRADERPTF
QQIVDTLQQHLNGKEVDMRDRSATASPAVKPRCTPANSPATSAGSNVERYANEASVLQSA
ANDQQTHKQRQHQQHQHQQLQNDVPLESYVDLTSAVHIDNATGSSPTTLPTATKTQQQQQ
QEGEQLDPYVDLSSAVHVDVQARDNDDSVVQLYTTYTGPRTDDDDDDDEGDGESESGALL
RVSPAVPDRPSLNPSRTAQNPTYGPGEACDQAGVYEEPQLQPTPAPATYEEPEPQTAATA
TYEEPLIHPAPRHGSIRLSNPDVPALVTEKQQPATRRPPRYNPPPRHHDV
Download sequence
Identical sequences PTSG_07959T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]