SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_07992T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_07992T0
Domain Number 1 Region: 95-127
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000185
Family TNF receptor-like 0.0023
Further Details:      
 
Domain Number 2 Region: 281-336
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000982
Family TNF receptor-like 0.0094
Further Details:      
 
Weak hits

Sequence:  PTSG_07992T0
Domain Number - Region: 233-267
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000489
Family TNF receptor-like 0.007
Further Details:      
 
Domain Number - Region: 160-189
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00459
Family TNF receptor-like 0.0049
Further Details:      
 
Domain Number - Region: 210-235
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00903
Family TNF receptor-like 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_07992T0
Sequence length 781
Comment | PTSG_07992 | Salpingoeca rosetta conserved hypothetical protein (782 aa)
Sequence
MPIGFSCGECERGYIEDGADGECIDIDECKEVEAACQAGTGCVNTDGCYECKDCAPGTWS
PGGSGACFSCTECEAGEEFFLRPCTPTQDAQCATCSTCAPGQAISRACSSTTNTICEPCA
AGITWSDGSLGKCAPCTVCADGEEYLEQPCSTSQDTECAQCSECKPGEFIIFPCTSRSGD
TECVPCLSCTENEYETSPCTSTQNRECRSCRDCDHGTFIASPCTPTQDRVCRSCTRCGAG
EFVKQACRMDSDTECATCTTCPAGSYTAVACTAERDAECKPCSVCEDSQLLLIRCSAGHD
AVCGSCGTGMYITGSKGATDTRRCVRQPQCPIGEGETVVPSLDVRRECAPLVPPVIPPTL
TEDRWQVAVIFRRLQPRPDLPFDEDVQFLMIEGLRLMFRQELGNATALFGVASVVEEPED
PSVTAVFQFELPDPSDHAEPTIAFRASSFASALVDVMSQLKDDNDDDNHYDHNNNDYHNY
NNNDYHNHNTDYHNHNNNHNNNDDDNNDHIHDDNNDHNNYDNNHDRNSDDNDNNNDDDHN
NNTGDSLTNIDDIEDDNENHNHYDHNNNNNHYDHNNNDYHNHNNSDYHNYNNNNHNNNDY
HNHNNNDHNHDDNDNNNDDDHNNNTGDSLTNIDDIEDDNDYHNHNNNDHNNDYDNPNNSN
SNDSDCYSPNHGCNNNRHRDDNDSNGDNCEFACNSDNDDRSQVHHFEWNCHDNCHNDGNS
SNSNGLKHHNHLSDELKHNHSQYHDSCCDFHANNSRSYNTHNHSECNHNADCFANISGHD
I
Download sequence
Identical sequences F2UGY0
XP_004991801.1.12839 PTSG_07992T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]