SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08029T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08029T0
Domain Number 1 Region: 12-119
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-34
Family N-terminal domain of xrcc1 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08029T0
Sequence length 242
Comment | PTSG_08029 | Salpingoeca rosetta predicted protein (243 aa)
Sequence
MKLCLGFLVRYAVWLQLDKASQITGIDVGNYGAAFMEVLVARSASGSSDTEYKTLLPVTK
LMSPSESKDWINVQAVHMFGDEKFNKDTRKHRWDSVRVVLRQPYCKTEEYGLTFIKVHTA
GGATSGGAASPSSSSSPAATTSSATASPSAPRTLGLFKLRREPTTSLSAGGLFFKRKSDK
GDTATSALREATRRHEEEKARRAKDAKAATPPTLPLTTDAPPAKDKDNGPCTHATAATHH
AP
Download sequence
Identical sequences PTSG_08029T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]