SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08128T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_08128T0
Domain Number - Region: 109-228
Classification Level Classification E-value
Superfamily Prefoldin 0.0366
Family Prefoldin 0.01
Further Details:      
 
Domain Number - Region: 885-1080
Classification Level Classification E-value
Superfamily Tropomyosin 0.0562
Family Tropomyosin 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08128T0
Sequence length 1087
Comment | PTSG_08128 | Salpingoeca rosetta predicted protein (1088 aa)
Sequence
MSSSSLRSGSLFGPGRRPRAASTTTTPLRVFDETLTPKTKQMIKMGVTPLRGAKKHNVKQ
ELRTLSNVSNTPLQNRRKRPKLQLQSTAAPAFDAVEATPSRKRGNSTRQVDRLKRALQDA
EAENEQLKQQIETLRGAAAPHAQQQQAQQQQAQLTNGTGGASADDDADHASTVSTPASKA
VPVAAGSASKQSSPEALEMLHCRAIGMIQHCLSRAEQHLEELNDSTTTTAASTPAQSNSA
HATSFTTSTTNGATTSEPRLLQSRVQEALTQLGTAAAPPSALPDTVTPGPYRKQRRAVAL
PPHMRHTAAINTAGSNTNGNSSVEGGQSPSSASSEQEHAGAVQTGFTPRVTHVRQILASL
VAPLRIFSPGKDSSEEARVSNAHTSDGERDSAAPASKLQPPRALPTIIIEDVDATPRRGK
VFQAEMGTSPMTPVAAATMSSTATMTSTPAKKQMSTTSTAMSPVVSEAMGAQTVHVSVQD
AETQASRVATPARPVLASTATSPLAIQQADMGTMTSPVADADGQVQACKDLPREQLLSQV
EVMAISNEVLRDENRRLGQQGSELRSTLQTVQQELGALKEHLLTSKEESDALVSQLQLRI
GELSQEKDDLEQRLASFADTEAVIESLTSERDTATAGLDAATQELESLKAELASLQEAMH
TEQREHSDTQAQMAQQVQEWEFKFTELTAEKEDLMQSFEALKAETADTQASLEAKIAQHQ
ASYTQLQGDMSTMYRQHKAEVTALEHKLQSNAYETRLAELVEENQLLTTRVSAMATAEAA
VKATAAKSAAAVTALQRITAVLEERAQQLEAELSAAQQARESAHAEVEFARAELQRMRED
HAVQERTAEDAREALDEMSFKCDELQVELEEATANAESAQQERDAAVAELQQTREMHTTA
QDALNQATTQVDALTEELEETKRQLARLSRRTEQTESEYEQTKQYLEQERAANRETITEL
EDCLQKTKAQLQVQEQGATTASQELEECRNLLEAQRTQVNALNDQLVDKEFALEQATTQL
QQATQIREHEVGKWMRRSNKLKTFIDEYKKRTEAKMEQLKKNYEAAEKEVSRLDRQLRAL
KRGQDHE
Download sequence
Identical sequences F2UI28
XP_004991149.1.12839 PTSG_08128T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]