SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08161T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08161T0
Domain Number 1 Region: 57-249,337-431
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.7e-33
Family ABC transporter ATPase domain-like 0.0031
Further Details:      
 
Domain Number 2 Region: 57-105,714-904
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.04e-17
Family ABC transporter ATPase domain-like 0.0094
Further Details:      
 
Weak hits

Sequence:  PTSG_08161T0
Domain Number - Region: 570-720
Classification Level Classification E-value
Superfamily Tropomyosin 0.00477
Family Tropomyosin 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08161T0
Sequence length 950
Comment | PTSG_08161 | Salpingoeca rosetta conserved hypothetical protein (951 aa)
Sequence
MAPTSRRRRHKEEAEVDDDGEFDDEVAEEQETANGDGPPAAKKSKTTSPSLYRDGAIVRM
KLENFVTYNHVEFRPGPSLNVVIGPNGTGKSSIVCAMALALAGKPSVLGRETKAAAFIRT
GANSATIEVELFQSSGQNMVVRRVIKKGNQNAFYINGKPTTEQNVRETVAKQGIQIDNLC
QFLPQDKVSAFAKKTPQELLVDTQRAKQLQPFRKAVEKAEKDKAQKEKNLSGVKPNIGKL
QRRLNKLQTQAADFSSSILTTLPPSPPAVITTITTVTTAATTLIRGMNCERKIAELTARL
SGQRDMQQIQADLREMRHRENEFTPQLDAIRDETQDLQASIQGRTRAIQKHKNAIQEAEN
AQKRKQAALEQRNGWMRDAIAWINDMNKFRMRVFPPLVLNINVQQSDVAALVEHSIPGRD
RIAFLCQCEDDQRMLVSTLRKQRGFPINVVRIPPDDLSSISAPLTPEEAQHFGIDGFLLD
AVDAPDRVKVYLAKVLYLHQTPYVRRKSRDIADGLKERGFKSFFIGTTGYRVMSSRFDRR
ADAMRLDEVKPAQLLALSVDTDRRQHLIGEIRRLEEEIETSQQQLQQLEARAAEIEEEKS
QFSQRIAALQEERHKVVDLSGKIKRYETSREAYNNQLHQLQVKKEVVQKEMADLIASSGS
YWREIEDTAQKLVGKMDVLTVLQLNLDRAEATVHVNTRAPEEEEDSLRAHAHVVKQLKDD
AARANNDNSMLTEEQKQEFAGLAKTIPGLEAAKADLQAQMHVIAPANASAVDAFESALKR
LEQHKGELREVQEKLKGFNAEMAAVAKQWKAELKKLNYEDWGIEISVSFRKDEALQPLRA
HHQSGGERSVSTMLYLMSLQRLTRCPFRVVDEINQGMDATNEKRVFEQVVNSSTSESSQY
FLITPKLLPDLPYNPAMTVLCVYNGPHMLTHSKWNLPSFLSARRRLALSA
Download sequence
Identical sequences F2UI64
XP_004991185.1.12839 PTSG_08161T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]