SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08164T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08164T0
Domain Number 1 Region: 988-1069
Classification Level Classification E-value
Superfamily SH2 domain 0.00000747
Family SH2 domain 0.005
Further Details:      
 
Weak hits

Sequence:  PTSG_08164T0
Domain Number - Region: 572-677
Classification Level Classification E-value
Superfamily Cadherin-like 0.0404
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 187-275
Classification Level Classification E-value
Superfamily Cadherin-like 0.0561
Family Cadherin 0.013
Further Details:      
 
Domain Number - Region: 53-183
Classification Level Classification E-value
Superfamily Cadherin-like 0.0987
Family Cadherin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08164T0
Sequence length 1406
Comment | PTSG_08164 | Salpingoeca rosetta hypothetical protein (1407 aa)
Sequence
MGLSNRVRAAPRSSRQKQLLWQYTLGLLLVLTVQSSWFEARPALLVSAVEDSHVPVFVAP
TPNVTAPLRLAQTAAANTHMFRVAAVHRTTGISANMTYAVNVTVAAHPPATFMHQGALVE
PLFHIDQSEGEVILARAPLFLPVGTLLNVTVTAHHRYRDDPFAHAATTLLPITIVSQSAA
APTCTLPSTVYVSSAAPIGSMVAAVEIMGGSLGQRSLLSIIPDNHLMPASTGDSSNSTST
PPVFDVDEHGNIVLLQSLESPPHLSTHDLVVRLSSEPHTIDLSTVKPGTVVAALLPAFTR
TADDVTTSSRAGAHHQCTLTRTQLIDTDGQYVDTVPTMLSSDSESVDDSDSSGSGSGSGS
GSGSGGGVFPFVQHHGTIAVIIPTFHHATCIHTSVDTSDMEQHSISHSHPGNVVSTEVPL
VVSIRDRVHNITETTSRFHQRNTTTTSSSGSGSVNTTAETVQHVLSLAVTMQGSESSADN
GDAQGSGSGEFVTSTTSMPFTTSTSIAQVTAVTPTSTTATSNYYDPHLLKEHTCEVDVVC
SGVDYEMLPHGRFSLYANVSARGASYIIPHTVRVRDVNEPPYATVLSRAFVAEHTLSTHT
DPTPVAHVLLLDEDLHAPFRDNTARVTTTSATAAAAGQFAIDSNNTLMARHPLDFEASPA
LPVTIAVDWRGSPGTTNSNMSVVAGDGRGGGGGDDDDGGGGSAVGGDSDNAMIHDGFPSN
VSFSHVVHVLDVNEAPAFNTAHIVAAVPANASAAAVTVSLPAVTDADMCSPWKDVSVVLL
SVLHCSNASTNAADQSVDGSSAPATSADSSTGGNGTHPGDVFQCTSLHAVDAVITHDNVT
SDGGGDGGGGDGDGGRVLSFNASSLLDVQAFVSFTVVAVDGAATATTATADGVTPTRDTS
IRSKLGLSRLGFILAAAGFATILLLIAVLAVWYMCLRRRQTSSDFASATFHTANSSGFKA
ATAHVSSAPELPLLNMRNSAVTTGSVYAELFGQAVGSFIVHDDGQQHRLFLKATQTECRQ
YDILRGRKGKFQLQTDDNTTQPLFQNLAQLIHHYETPRSCLPVPLMRIVAETNVDEPQRM
QAWGTRGGHVGKHSSVSIDQTSQEDGDVEMLDVTAPLPHAANLHGHSSGVIDDDVGIATT
TFTRQTSGKIAAAGAYALPEEGGDMRDASADGHRQEEANFSAESDNDDSSSHSSDDEDDM
NEASEQHSTQHAHEKAQVSVVTAGELNLDDSRGRTHTEIRRKGEYLSIDGNTSAVLVLQD
DADGFPHNDSTCTDENDAIDDAAHEVFQFDDTRNRADTVFTQPEGSLVFVKSRNGSRRSN
TSDRSSSAYPTFHDHGGDGFQQQHTTVLNTPVTYITSPPPPAAHHHDVDEELLGSPPGAI
FDRSASSTRSRQVKLSDSDTMQDVDA
Download sequence
Identical sequences PTSG_08164T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]