SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08181T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08181T0
Domain Number 1 Region: 3061-3124,3153-3383
Classification Level Classification E-value
Superfamily Kelch motif 8.11e-36
Family Kelch motif 0.0096
Further Details:      
 
Domain Number 2 Region: 209-253,322-462
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-22
Family Kelch motif 0.016
Further Details:      
 
Domain Number 3 Region: 2864-2977
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000824
Family Spermadhesin, CUB domain 0.0022
Further Details:      
 
Domain Number 4 Region: 9-93
Classification Level Classification E-value
Superfamily Kelch motif 0.000000000275
Family Kelch motif 0.038
Further Details:      
 
Domain Number 5 Region: 2050-2124,2157-2216
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000235
Family Growth factor receptor domain 0.007
Further Details:      
 
Domain Number 6 Region: 2759-2807
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000963
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 7 Region: 3689-3712,3800-3907
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000573
Family Growth factor receptor domain 0.0086
Further Details:      
 
Domain Number 8 Region: 3890-3937
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000067
Family Laminin-type module 0.01
Further Details:      
 
Weak hits

Sequence:  PTSG_08181T0
Domain Number - Region: 3941-3989
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00146
Family Laminin-type module 0.024
Further Details:      
 
Domain Number - Region: 2266-2383
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00487
Family Growth factor receptor domain 0.0077
Further Details:      
 
Domain Number - Region: 1749-1849
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00612
Family Growth factor receptor domain 0.0074
Further Details:      
 
Domain Number - Region: 2807-2851
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0105
Family Laminin-type module 0.0088
Further Details:      
 
Domain Number - Region: 1533-1572
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0117
Family EGF-type module 0.025
Further Details:      
 
Domain Number - Region: 1153-1199,1226-1239
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.0366
Family Anthrax protective antigen 0.041
Further Details:      
 
Domain Number - Region: 2353-2455
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0385
Family Growth factor receptor domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08181T0
Sequence length 4780
Comment | PTSG_08181 | Salpingoeca rosetta wnt inhibitory factor 1 (4781 aa)
Sequence
MRYFPPASGTVYVFGGHSFGEFFGDLLALNLDTMVWTSVWQPPSPQLSSGAVDAFPSPRH
SATLSLYAGVLVLVGGVTEHGISSDIWLFNTTAPSAGWMQVVPTEVCVSTCPLGAVYRNA
RCVVDPDAPTNGDGDGDDGSPSATTTAPAPATSLEPGTGNATASATMTAATSAATAMTPA
APSPTATTAAPGPSSTSTAPRMVCERGTLPPLADHTATVVGDFIFLIGGRAPDDEFSGVM
HRLNMQAPPPPTHTHASTSHDSTNTTNSTSIANHTTTTITTTITTTTTTTTTTTGPASSS
AFAGLHVGVERIPVAKPLFLEVVGHTSVYHPPTDSIYVFGGFKPYHARYADERDALYIFH
VAELAWSTPRTPRGNAPPGLAFHTATLLDDTMVLYGGTHHVHYEEEICYSNHMHVYHFRC
NAWSLETDVTDQGITRGRQGHAAVAADSNTLVVVGGFDGRTRGDVLLVRGSPGWCSAHAD
EDSCIATTACGACVQPAGTGGDDSGAVMRAFVELHNSTLAPSPWLVRASEAAAATAPATA
LAVASHYAASVTAAHVMTAANVVACLKACADLGDACVGVSVEQLSDGTVNCTLASVSTKC
APFAGASVLFRPSTPQADAFVVYEKRTLAAAPCALHQPILQALEDHLRDAQQHQLLYQRC
LSVSATGPHCTCAPNAARNTSLSSLQCYPTTNCSSTDPAPSSPVPCPPTSNATSQQQEQQ
QQPRCFGADAPYLLHITPGNSSAAFACVSARDCIALRGVPTPAAQPADARTQPDLCAFDS
ISPYPALIGSSSSPSSSPSSSPSPASTLTSSAAPPTTTAAGTSMGMIDDNTMLPFCFADP
TTAGQLFRNQSDFHTTLLTADDPPTLSATVAFVPAFDPLLAIADTPAAVAGAVPDARHGD
CYVSAMATQPLWSATLAAPTPIATVVVQGSTPSCFDAPGAGPAAQQLCIPETQDVRVVVG
TDPTHVLAGKTCGSVRLNGGQPATVSCGGEVASVIIVLAQAGPTMLTLCSVRAFAASDAA
AVEDGVACGSRGDGVWMSGACTSHCNAHRQCSECAADDLCVWCHGTSTCVSLFADSGAAL
DEEDACPTAMDVPVTSTSQCHLHRPTTGITREQFFDLRGSWTLHGFRTSFEFQHSFPSTS
QIITSSFAVSDTDENFGERIHGYFVPAATDTYRFYIRSRQGYYAELFLNTNASAVDPAST
AVIVARQSPTSSRPQQSFTDSSVQSLAAVHLSKGARYYIASHVFVYSRSSFGRHEVAVAA
KRASDPTGVSDADIIPGARLRPFEADVCSSIDNCFGCTAAANCGWCGNTCMPLDRVSPST
CTSFAYTDDQCAQCNEFTDCDECIATAHCEWILYACRRVSGHSLAVTATNDLSCPVPCTE
RTSCATCTDSQSCGWCASTNTCFDFNGYLTRFADGECESWHTSASTCPDCSAHTTCTSCV
ADFQCGWLYAHDNAAVGACISGDFAGPFNRSAAAVPESLLEAIANTSQLFSPHNTSSSST
VISPANSTNSTSDTTRAAADMYPLAYVYDTCPDVDECRFEYDDCPGNATCVDEPSGEHLR
SYRCECNPGYAATTAGTGEGGGGQGLMCTPMCPGCVQGDCIAPNTCQCHRFFSGANCTEC
TPIGSLLPSATTTTTQPTTNTTAHNTTASVNGTTTSPATTMLRVNVCGANAVCAPPGWNT
SLPFNVSEHISGYPSSPSSPSSSSSSPAFECQCAPDYAAPVHASAGCEPQCTTHGCVHGT
CVAPDTCACDEGWEGANCTTCVQGAHDECHEDAVCYDANGDLGCRCKDGYAGNGRTACFP
VCVPACSDFGTCVAPNQCECQTGFTGLVCDKCNASQAQTVHGCDEHATCRVDLDPLTLVW
TQSCECNRGYHGSGKVCDATCAACEFGQCTEPEVCTCAPFASGAACDACANATMCSSVAF
CAKSLPDLTAILTNGSSSSNSTAPGGGGGSAALIPHRRHIPLEGETTRYVVAVEQGTRAP
SSAETAASVMINTTFIEHSHEFCACPPGFEGDGLTCTPVCSQGCVNGQCSYAARVDGTFG
NCTCAVGFVGDDCSVCVPGVAECAANATCKASTNGHMMCQCDDGFAGDGNVACAPVCTQG
CVHGTCVAPNTCACQVGFAGNNCTMCDMTAADYPCAPEALCTMEPAPSTATGFAPRCTCP
PGYAGDGSVCEPVCSACMFGTCTAPETCTCDEGFVGDACAFCDPQHPPCGLHASCVPVHN
NNNSSSNNSNNNNHNNNNNSSSSTTTTATATISNATAMTNSSSTTNSTMRGVCQCDDGYA
GDALLGCAPVCAHACQNGNCTAPDTCTCNPGFMGPLCEQCVPDDHRCTAHASCVFLNATT
TTTTSSTTSSSTSSEKSAGFYCICDEGYVRRGSACEPVCLQGCVHGSCIAPGMCACDDGW
LNVDAANCTECNPDGASSSSSSSSSNDNGATSVCTEHATCNAASRACECDVGYAPQGQVA
GGYGSCSPVCAPACVHGTCVAPNACNCQDDWGGPTCEACPPNTICSARGSVCDKLSDAQV
LAFSSKYPGFRFVFETNTTADLLRQYQCTCAHGWAGDGATCQPVCDEPCVHGECTGHNTC
TCDTSENSGNPAWAGPLCTDCIAIEHGCHPNATCASSSSSSSGDVTCQCKPGFEGDGRTC
SPVCEDGCVHGTCVAPNTCVCDASTFDDSDSGVPAWAGADCSICLPEQHGCHPNASCTAK
TAPLGADPPIACVCNDGYEGDGMACAPICTDPCVNGTCTAPDVCSCHLGFTGENCDVNCM
CSFSSSCEDQGPGVCDACQLHTTGTFCERCEEGFYGDPGSGVPCQPCPCNGHGTCHHRTG
ECTCDETTQGTHCNSCASGYHGNPSNGGPCYRYCTQDVNRIVLTAGEGWISSGPSTSCSY
SSSKRCHALERACVFVIAANDSTSSIRLETEELEVECVYDSLRVLEGASQFSPEIAVLTG
FTPPPPIVSRGAVTLQWFSDFTWAEKGFKMHYVIERCPFMCNGRGTCDEATGVCHCSAGW
QGEACDVEVCPNNCSVALGQGVCVEDDTGGDGAGGGGGYKRCVCMHGFTGRDCGDPPHHG
GWNEYLERMPEPLAGASAVYDPVTSAVLLFGGRPPQVIRDPALSNALVAFDVSTRTFTTI
HGSTEGDGSAAGAADNSGDASSSDGDGLRGGVPTARYGHTAVLSVERRQMFVFGGRLQST
RVSNSLFVYDVDADVWEHVKPLGDELEPRFAHTATLVDGRMYVIGGVSNDDGLVFRAQVF
DLDTLNVETLPPSGAHPAGLLGATAVFSPAANRILLVGGVGLERQINGIYNSRKRFAYRA
VRLQDDVYAFDVRNATWASVAPLPRARAFHASFLLDRFLVRSSLGITVTFAGNSFQHGSG
GDCPDSSVYVYDTQCDEWLSADSALVQLFSQEEVPFGRSFAATAHIIHGDTHMHDAAAPS
LATNGSSSTSGGGRAGGTSGGDASGADGVVLTQPPESAWMFGGFGRTMLDDVYEIRLPNC
SAAHANATQCTQTSGCVWCGDDDGGGGSCVLGVGATAEDTCARESTCAAPPSCSTIRTCG
QCASRDDCYWVITTTGQFAGLAGTCHSAAGTAATGIQANYCDQCGIRSSCKACTDPEFLY
ECGWFEQSTFNEHFCFDKESPINAIPDTIEEQAGCPAACSSLQSCDACEQAVGCQWCGSS
QVCQETNLFPDLNAVGECANDDVQAGNDVCPRECSSYSTCSSCLQNSRCGWCVDPVSGEG
ACAAGGAVGPYDTTSMCFGLVDQQSVSMAVASVLAGSIDRDVNTSTGTASDGGGDDGGPG
LASTGLDRTSATNTTLQWWYFSCPDRNECEQTPQPCDANATCTNIVAPRFPGSDDKSYEC
VCNDGFEGDGSVCTPVCDTFGCSPQHGTCVAPDVCQCDTGFTGVNCTQLCPCNKHSSCDS
GGCDMCEHNTEGTMCERCAPGFFGDATAGTPTDCKPCMDVCNGHSTECFSSMDAANGAAV
CKRCDPESHTTGQFCDECMDGYYRDPDAFTNSQQVLCLPCECNGRGDACNPLTGTDCQCF
SDMHAITRNPEHQCGSCEPGYVATGLGAGLVDLRPGDACHRAINLTAVTSTSSGGEHVGR
IELQPNRAPYRVALLPVGRGAYRPFRNAMVEFTELEGEVVVDVMSEGAAGAQSCADSTCR
RFLCSEFSGSCTQLTLTPDTPATASGNGGVDNDDDDVAGVADDDGTVMRRSARSSTDADA
NAVVGGGGGSADVNVDAVLLSPTVPPSSSSSSSSSSSSSPSNLRVTLDCSAFNFLQDVVF
VTVRAARTRESAAVAFTIGYTPANEDEDGLQCAACLDCPVPCVPGYFLDPDTPERFRCRA
CECNGHGDRCNVLTGDSCGLAAEGCDVVTGEDCRCAHNTVSLQVRANMLPYEYQCNRCRD
LIQTSSGMVVLSGTPENGKQCYRQIVQQAVQSPSLQAGESQFFVFTPGIFTNVDLRVTID
VWQGTVAAVVATDNGTVVDLLGDGENTENTDANATLATPAASSSSSSNGNAGSGGSGSST
GGRGMLEPLQLAEGFVVPSNATVRRDVIEAERAYMRFSHRQFNFSTTVFYLTVVNLGPEP
AQLRVFSSQPVVSIDLVVFFTVFFCVFFLIGAMVVGAYKLNSLYHVRQSAREEVLAMETL
ARRPFATATLMLRRDAQGKQHARAKPARWMSPLSSSSSSSSSLKPRGVLTSSSGSPASAP
GAASKHTPSSSSSSSVPAGKRGEEPVPVAVQPLAAPRKHEAIATYVIELPGGRGDGLPTL
SLGIAHMTTQKQGHLRKRRRRHKGKRGIAVNPMPIDNTHV
Download sequence
Identical sequences PTSG_08181T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]