SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08183T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08183T0
Domain Number 1 Region: 26-77,124-349,447-486
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.48e-63
Family Type II chitinase 0.0000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08183T0
Sequence length 528
Comment | PTSG_08183 | Salpingoeca rosetta chitinase (529 aa)
Sequence
MHATLLVCVILACTAWSAHAMVFGNYFANWAQYRLGNYAYTPKNLAPVADKFDYIVYAFA
WMNGGCDGCKGDTVYDWIGQCQYSNGTCAMYSNGTRDAPECPMGASPCTANNFTLVSPEP
ADPQFYEQVVAFKNDNPDLKILLSVGGWNFPSSIFSEMVASKESRTAFIKSTQEFMDKYN
FDGIDVDWEFWCSGPRSDHIKLSNKSFHNLYDVGGKCPDDGQNLLTLVTEIRSAYGKDKM
ITLATQADLQKMESIDIKAVSEQIDYWHLMAYDYSVSDLPEMCGDAPCFANFTAPNQPLY
AVKEGQIPKHDPPFPSSFWSVNYTVQGYLDKGAPADKLVLGLTFYGHSWYIPNQSNWKRF
GVPAALSHACYGPFNPTFGAWPGARARLCGLLIYSEIVALIDETDPEQNFFDPATQSDIG
YIKDGSRAGEDLRNATPGYVSWNSIRSLSAITNYAKKQGIAGVFAFDASMDVFVDKSYPV
VNAVYNITSGGKPGSNQCDPSKGCNVCSACCKSYIKVRSGVYGACGVL
Download sequence
Identical sequences F2UI87
XP_004991208.1.12839 PTSG_08183T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]