SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08220T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08220T0
Domain Number 1 Region: 187-334,378-620
Classification Level Classification E-value
Superfamily (Trans)glycosidases 6.92e-102
Family Amylase, catalytic domain 0.000000199
Further Details:      
 
Weak hits

Sequence:  PTSG_08220T0
Domain Number - Region: 625-695
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00327
Family alpha-Amylases, C-terminal beta-sheet domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08220T0
Sequence length 750
Comment | PTSG_08220 | Salpingoeca rosetta maltodextrin glucosidase (751 aa)
Sequence
MFFAFHGQTSEWASPVGKHKPQLLVWLATAPLDEDDVGGDGGESQGFAFDRVAVRCDPDN
EEHLVSMAKLSSLERHSFKLSDQPEADPQPDSNTQSHTATATAANGNDDDDGGGGDEGVL
ELTPPRVRSSRLCFWCACIPLNEDRDQTHYVFKFIQGRRQWWLDARGELVPRLPGKEYHF
RYNQSCKPPSWVASQVFYQIFPDRFCNGDPSISVKEGEYLYLGHPVHAREWGQPVTDTDE
ARCSEFYGGDLIGVRNRLSYLCDELGVTALYLNPVFTSLSNHKYDTVDYMNVDPHLGGNG
ALQHLCKDVHARGMRIILDAVLNHTSVHHHWFDNEGGGEQEEGTSGEARAVVDTEADEVL
EAEEVVVEGGADMGKGDDYVAWLGYDSLPKLNLANPQVRAYLYAEERAVIRHWLRPPYAI
DGWRFDVIHMLGEGANATNNAFYVRQFRQATKETNPQAYVLGEHFYEATQWLQGDQEDGC
MAYYTFLHPMRAFFAGTDLIGDPIHLDASELSSWLCESRAKIPWENQLALFNQLDSHDTP
RMLTLLGGDVAKLKAAATVLFAYPGTPCIYYGDEVGVEGGKDPDCRRCFPWNRQEWRQDL
FAHYQRLVAVRKATPALQYGAYVPLYAHGDVFAFARWLAGTVVICVAVRSGGTIATTAST
AEEGQRAAAIVLPVWKCGLDEGAVLTNVLAGHATNADDDADDDDADDDSSGSFVVSRGGW
LDITSSTSTFTSMSTSPSTIHGSALLVAKM
Download sequence
Identical sequences PTSG_08220T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]