SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08221T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08221T0
Domain Number 1 Region: 420-691
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.2e-46
Family beta-glycanases 0.008
Further Details:      
 
Domain Number 2 Region: 160-336
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.25e-43
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.018
Further Details:      
 
Domain Number 3 Region: 338-424
Classification Level Classification E-value
Superfamily beta-Galactosidase/glucuronidase domain 0.0000000000000403
Family beta-Galactosidase/glucuronidase domain 0.005
Further Details:      
 
Weak hits

Sequence:  PTSG_08221T0
Domain Number - Region: 54-108
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0824
Family Hairpin loop containing domain 0.098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08221T0
Sequence length 710
Comment | PTSG_08221 | Salpingoeca rosetta beta-galactosidase (711 aa)
Sequence
MAEGVVLLLVALLLLTVAAAGTADAVQTGGDQDPCTCGPFSYANPSKPGPGPTTYETGVD
YPGNDMAPCGSNGCTMPTSTTHLDCETKCNTTAGCVAYVFSTSGCDVPKGSNTCWLKNRV
GVKVPNTCRNSRIVKQAPGEPPYCPLTTKWAKEVNPSTSVPLPEYPRPQMVRDTNWTNLN
GWWEFQPADPKQQPPFGKKLNSTVNVPFPVEACLSGVWQTHMHLWYRRVFARPSPASSSD
RVLLHFGAVDWQTQVFVNKQLVGTHTGGYDGFTFDITSYLRTSAENELFVSVYDPSDYGQ
QVFGKQRISAITAAGGDTYTPSSGIWQTVWLEVVPQVHIANVTLLADLTTLTMTVNASDG
SSRPFSYTVHDGSSKVVSGNGTSGAPHRVTIPNPKLWSPASPFLYNITITMGADTVTSYF
GMRTFTLGKDEHGVTRPLLNGNYTFLAGWLDQSYWPDGQYTAPTDEALASDLYAVKRYGL
NMVRLHQKVNSERWYYYADLLGIVVFQDMVQHYGDAHGIKPDPDLYFQDLRAMIVGRFNH
PCIVQWEAFNEGDMVAHFNPQQAVDFIRALDPSRLVDTDSGGPANNLHIGDVNDIHDYPN
PQDPKPSDTQYAMIGEFGGIGAFIPGKEWWPAQCHTYLHVDTPLEEANTYINMTNMIYNW
RSDISASVYTQITDVELECDGFMTYDRVDKFDSDTIGRIAKANQRLIHGN
Download sequence
Identical sequences F2UIC5
PTSG_08221T0 XP_004991246.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]