SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08331T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08331T0
Domain Number 1 Region: 480-611
Classification Level Classification E-value
Superfamily Cu,Zn superoxide dismutase-like 0.0000000709
Family Cu,Zn superoxide dismutase-like 0.0063
Further Details:      
 
Weak hits

Sequence:  PTSG_08331T0
Domain Number - Region: 694-757
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00012
Family Complement control module/SCR domain 0.0038
Further Details:      
 
Domain Number - Region: 425-471
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000306
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number - Region: 1038-1101
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00256
Family TNF receptor-like 0.0037
Further Details:      
 
Domain Number - Region: 240-312
Classification Level Classification E-value
Superfamily Invasin/intimin cell-adhesion fragments 0.00392
Family Invasin/intimin cell-adhesion fragments 0.0051
Further Details:      
 
Domain Number - Region: 909-945
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0479
Family TNF receptor-like 0.0076
Further Details:      
 
Domain Number - Region: 622-670
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0659
Family TNF receptor-like 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08331T0
Sequence length 1705
Comment | PTSG_08331 | Salpingoeca rosetta hypothetical protein (1706 aa)
Sequence
MRGADILVALQMLLLLLLAATEVASQSILLQIDNTEVVQPDFVSTEATIQVRPSLSRSLR
SSNTESFLVLSGMRSFTVPEAFDSSTVSAVVKKTQVVTLSIASPPQGYTTNSVNLTVHAG
PIDSIEVSYNTTTAAAGETIGVSLAAYDQYSNLLDSGPNVYDDTITVAVQGTATAPASFE
VANGVGSTVITSTVAGVSIVTLSGFPQVVVIGRSEDIQYVAGPTARFTLTTDAESYSQGD
TATVTVTAEDDYGNTVTSESRALAIVTTAGNSVTVSNSGILSFSSGEADVTITSASAQVV
EVALDANGEDVTGVDISDTSTLLFAVVCDGVTEYQDEPNQLTCKTVRSDCGVGTFESAAP
TPTSNRECSACDGVTEYQDEANQTSCKTVAGTCTAGEYEAQSPDASTNRMCTACDGVTEY
QDEADQSECKTVRVCNVGAQVSVDPTPSSNRQCELCPSGFVDEDFNGLTPCSPCSASVVM
MATFDSDDAMGTVTFNANAATTETNITAQVTLATAATSLKVLTSPPVRGTCASALFNPTS
SDGSGCSSSSPSSCIAGDISGRLTVDLSAQGTMVAFEETTTALAFIGATSLQGRALVFED
GGGNVIACARIDTVSGLSFQSNAGQTMCTEVTPCSVGQEELVAPTTSSDRQCSACDGAAF
FQAEEDQRFCIDVRECPLGEEEAVAPTASSDRECQTVTCPGLSAPLYGSITTCSGDQDYG
TFCNATCNTGDGFELTGTANRRCTEFGTFSGTKAECVCSGDLFLDPVAEECVAKCPTETY
TDSDGVCTACRAVCEDGVNYETVPCSQVNNTNRVCATCRTCPTGEFKTGGCAAGEDTICS
TFSECASGEFESFPGNATTNRRCDMCTPCPLTEFAETGCCSDIDTQCRALTVCVEGEFEA
RAPWDAPQGGYATDRVCQRYRTCAEGEYEVFAGNTTHDRVCSPCTVCSDGMYAAQACTNT
SDAVCMPHTNCTAGQSYVFTPPSSYNDTVCAQCTECSPHEYQAGGCDGTVDTLCALKTVC
DPLTEYESFPGNETADRECSTCSTCPSGQIATSACTSTMDTVCEEDNGGMAACPRGQVLI
GTPPNAVCVECSDCPNGTWAEGGPSCPSGFLSPVCTAVTTCEDGQYISQQPTPTSDRICS
TCSACSNGFFRSGGCNGTEDSQCSAAHTCAQDEFEITPPGPQSDRVCSPCRQCEEGEFEI
QACTASSDTICRTFQECSTLERVIAEGTTGSDRVCHMCAGRRAGVVEDRTQCPPFALSLC
EPTTTTTTTTLLTTTSAPSTTPMSTAATTSAAATPPPTTTTTTTTTTTTRAAWTYVEFSI
EGDLDAIEDLETFLLQLRISLAEAMNTTISAIQNLQVRRGSIVVGFRVVDDTMQLHEASS
QTIVDLANQGAFAFSFQGQSYQSIQSSASSTPNGGPQESSSSVPVGAVAGGVVGGVVLIL
VVLFAVLVHRRRQHSRDDVEKSPLKDRQRSSLTRGSSRSARKQSLPGGDDDYLAVDPNEE
PPATETATALTSLDENPLMDTKDFALETVPEATEPVVAEEGTVYSSQLSQENQKLRDELQ
RMQEMLVQKEAATATTRFGSGEEEVESALTQRLRDQNKQLKREIAEMKASMQRTKQQSRL
QQEALVNVRLKMEKASLAEELAAIEQVTQVRNQTSAQLREKRAEQQRKLEEEEKRKERER
IQREIEEMKSRLAQLGGDQAGAPPS
Download sequence
Identical sequences PTSG_08331T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]