SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08390T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08390T0
Domain Number 1 Region: 4390-4662
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.94e-83
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.00000633
Further Details:      
 
Domain Number 2 Region: 4037-4160
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000926
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 3 Region: 4163-4203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000185
Family EGF-type module 0.0062
Further Details:      
 
Domain Number 4 Region: 1324-1365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000538
Family EGF-type module 0.0054
Further Details:      
 
Domain Number 5 Region: 4009-4051
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000197
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 6 Region: 3976-4017
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000344
Family EGF-type module 0.013
Further Details:      
 
Domain Number 7 Region: 1385-1492
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000753
Family Growth factor receptor domain 0.0082
Further Details:      
 
Domain Number 8 Region: 3742-3797
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000000981
Family Type I dockerin domain 0.0062
Further Details:      
 
Domain Number 9 Region: 170-266
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000534
Family Growth factor receptor domain 0.0056
Further Details:      
 
Domain Number 10 Region: 1497-1556,1658-1729
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000738
Family Growth factor receptor domain 0.0092
Further Details:      
 
Domain Number 11 Region: 1917-1949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000138
Family EGF-type module 0.032
Further Details:      
 
Domain Number 12 Region: 1857-1897
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000033
Family EGF-type module 0.019
Further Details:      
 
Domain Number 13 Region: 3545-3668
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000598
Family Cellulose-binding domain family III 0.015
Further Details:      
 
Domain Number 14 Region: 105-143
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000153
Family EGF-type module 0.022
Further Details:      
 
Weak hits

Sequence:  PTSG_08390T0
Domain Number - Region: 4203-4240
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000184
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 146-181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000648
Family EGF-type module 0.014
Further Details:      
 
Domain Number - Region: 27-56
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000686
Family EGF-type module 0.016
Further Details:      
 
Domain Number - Region: 75-109
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000809
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 1292-1328
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00181
Family EGF-type module 0.019
Further Details:      
 
Domain Number - Region: 343-465
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0413
Family Growth factor receptor domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08390T0
Sequence length 4668
Comment | PTSG_08390 | Salpingoeca rosetta Notch2 (4669 aa)
Sequence
MALRLARAGLFLLAAAALFFISPLGAEAACPCQNGGTCVGDTCSCVPGFSGDSCETLEDC
YLVQAHLYQQLGTLVNPCLNGGVCQPSGECLCPVTASGSFCENIVDPCAGDANPCLNGAT
CAVDNGAVVCNCAPGFEGSTCSEVVQPCVPDPCQNGAACVQTGPESYMCECTIGWGGDDC
SLAVDPCTFDPCNNGGECTSSGADYSCTCAPGFVGPTCDIECTDSGCAECLTTDPSVCTL
CQAPLYLHDNVCLDTCPSGLVTDPYSSVPSDSTEIGPRVCGEWTGVPKLEGALFHTSVTP
AEVCRRLGLSWSDELSLAAPTTGRSTVCSIWYPGAELVEFSPCDSEPHLASITCSALCGL
NCDVCQDSSTCDVCEAGYFVSASGTCVPSSECGSGFYADTTTGNCQPCQECASGSYATAT
CTEFADTVCEDWTVCSENQIVFIAGSSTRDVVCRTCSTCGANQYVSRRCFVQTVNNLPVF
RDTACSTCTTCDAGEFVEQACTATTDTVCGVCSTCPTGFYVSTPCTSAQDTVCSAITACA
AGEYISKAATPNADQQCSPITECVAGEEYLATPATATSDNVCRPITECGANQYELHAPTE
TSDRVCTACSTCPTNEHIVLACGGTQDTQCSGCSTCTPGETFIQQPCTVFSDTVCAPCSE
CAAGTFLVATCAGPDDTVCGPCTPCSSTQYQVEACTSTRNTQCAALTVCSSTEYESVAAT
ATTDRTCVAVSTCGTNEYQSKAPTTTTDRQCSAVTTCTEDEFERYPPSRVTDRVCAALTV
CHAELQYELVAPTTTSDRVCRRLTTCSLDEGTYELFAPTATTDRVCAPVRECEEGAEYEA
TAPTPTSNRVCQPLSPCPEQLTYEAVAATPTSDRTCLADKYCSFSAELTNFAGDGSGRVF
ATFTDPTAHLDLQIVSDAKACADQCFLRSSCKGFVLALETVTTTTSASTALTCTLLSRLG
DAHGVTTGLVTASYARVAVQEYEVQSPTTSTPRQCAAVTQCSPEVEFEILAPTATTDREC
SALTQCEAAAEYETVAPTATSDRECVALSTCNEELEYEATPPTATTDRVCELFTSCLATE
YAVVLASPTNDRVCEALTTCNFAQQYETVAPTFSSDRECTALSVCSGAEYELQPPSVTQD
RVCEAVSMCTSTEYEARAPTESSDRVCLALTECLAGVQFELQPPTATTDRVCTTYTACRP
LTEFESRAPTTTTDRVCSPFTVCDPAAQYQSVPGTATSNRVCTALTQCELGITFETQAPT
PTMDRVCSACSTCDAGAGEVITGECSLTADTACMACPCQNGVQCTQLNPVGYKCECPAGL
SGEFCEINADDCASSPCQNGATCVDLINGYECNCFPGWSGETCTVLANCNAYRFEVLART
GLRINPCAPGTCDADDTCSCPSGFTGSYCEVNIDDCESHACENGGTCVDGVNSYTCRCPV
GTYGDLCEFNEDDCFDGACQNGGTCVDGINSYTCDCPPGFVGETCTEETIECSPNPCENG
GTCIEGQATFTCDCPSGFGGPTCADICPQDCVSCSSADVCTMCTNYKYLDAGECRDSCAA
SSSLADVYGAVEYRSGSSAATAHETGRVCGAWTGQPVLDGYLFHRTWTVNALCEAIGLAP
PTDALVAATETLISYDRMGVCRIWYPSQGLVTLVQQPPCDDSEPYVSEVTCSALCVDTGC
GACDLSGRCTSCVYPQLLKDGACVSESECGVGFFAHVAEDGSGVCEACTVCGADEYETTP
CSLDGNRECAPLTACDAFGEFFVLTAATATTDRVCKACTVCDSDAFASGGCQGEQDTLCQ
PLTRCSQDQYEAVAATPTSDRVCMDISKCAAEAGEYEFAAPTATTDRICCADGTTGPQCS
EPSSDCCMNGGTCVQDALGTGRECVCIPGYAGVSCEVLQDCLMVVGYFASETGSRLDPCE
NGGMCQYDVAEQRGVCQCQPGFAGDACEESAFMAGDVIPGYELVHVGGNGGRRFTTAFDA
ASTILVLHNVLEATCVLECNTQEACEGIFFWQRSATELRCYLLSDTGSSAGVVTSTDSFS
YAKGTSSDGPRRFSTAFQSQYELAVLDVDAAIECLQECDALDACAGVFLREATTTMRCHL
LSDLGAEAGIATSTTSLSLRKLLDTTTTTTTTTTTTTTTTTTTTTTTTTTTTDVLGFAFE
DNGYVVVFEGVQGMSGSPRRFSSAFVPSLELAVVSTTQARTCVNLCDADDRCLALFIFER
SSDYQCRLLAEFGTETGTATSTTSLSLVKLPKTTTTTSTTTTTTTTTTTTTSTTTTTSST
TTTTTATTTTTSSTTAIFEYPFDESEYEVVFRGVSAFNAGAPVRFSTAFDARFELQVISV
FDTTGYDVVFVGTQGGVSSPRRFSTAFDSTFRLPLTAPVTTGAECLQASTISIDVPNTAP
DFSETEATTTLTIDASYDTVDLAQLQSDVLESLATTGVSSDDVAFVHFYPGSINILVGFR
TQAAYTTLTAALATGPLPVGNATVSLLTTSMQPYVSSNDAFVAYKTSTSEPGFNLVALDN
LKPGLKVAVTSAVGPLSVDMEVTTPRLSPTTFKAVVLPASGNVWFNDPTVSVFIRFEDER
GSALVAEGSTAIVTVSPPASLGAAASPLTTVCVSKLDEQEGAVCTATVTLPSSWFSYEQD
EDVRVTAALLSDISSTSTVIADLTLKQQPSVALATGYGVVCRFPQGSVFSESGFDIDCFG
RARDGVALTQFQLQLTPSAATISFGQVTSTDMWGVTARTVSGKLVVTGSRVSSTDTGSTG
DEFMHLFSVRARAGTTTSSFSVRVTVRVQEMLSLAGRVVPVNSLAHVTDANVTPTQRSAT
TTVVAVDTAGVLAWIESPLLVNTAPLAPTPDARVSRSMTVLAINTDGTVLASDSHFCAGA
GVTQATGCTEVSFGSTDPTDGRIEVTVLLGTAQDTVALNVMRLDSVQLDVSNTQLHFVTT
AAALGNCTGTFQQARVGIRAVFVAGVRSVIVDVTHMAPWLLQMSNEDTVQLVGAQAGEGE
YDVDLHLALTGGRAVLQGMAPGTVQLQLVSPSVPGLVWDSEDVTVLGSSGHVATHVRTLL
AVDVQVGAAAPSLTAFGSNGPDVSVGVSSSVKASFSELLQPGVAVSVIVDAQGGEILVLS
SDAGPVPNIALNREASNADVMDVDAVMLADGSVVMETTSVIGVVNTNQQGQDVHVRTTAA
MCGGAAVLEGRETFPVQFLDVVSVQYNVSTNVIAMAGSPAVAAGVSSRVQLRIVATREDG
STRDVTLDPRVIIDTQTFGLGALVVGSSTQDGRLTIEATRVVQGAAVVVSFEGFNQTLPI
TVVEAVRLDLSAHPYPPYPGSESVSASPLEAIGSTGRFQEAQLLALLSLSNGDQIDVTAH
PDIEFDISVPELYVAETLLLATGETLGSVTASFAAGGIVSNVLQMEVTSTQRQVAQVVVE
APAALSGLMGDVYAGAVQVTLVLDDGTRLQHGYLFNATTQQPNFPGMITFSSSQEEAVVV
DAATGALTIAGNTKRGPAVITATSGGVQGTASLRINLDVADLDMDMGNLAAADEPIPTQS
TSQAFSVPLVLRLPTTVESVDALQFQLSFDPAVLSVLYVTAGDGWSNSRLFVDIDASAGV
IRSGGIFPLLKGGADDPTLVEIAVITFEVKSTAPAGYTDLAGRFDVFSSMGSTIVAAGTP
FVAGDVSVLIQSSSSSSSSSAAAAATADNGRRRRRNLLSLEPFDVTNQIVFGDEGKEGVV
DVEADGVRGAAPRKRRDVQVNGDVNLDGVFDLADVLFLYGYLAGYNTDVTPEQLLEMDIN
GDSQINTADFLYSQKVVANEYRFLEVSRVASVSLATDCRFVVEVTTRDASGAPESEDTIV
FVDLESPSEGFHQRMVASEFLFGTPVEAKPAPFNGTIVRAAATGNGTHTVAFDSSIVAGA
KVGVSFFVATLDSNGSPSADRITPLLTGPSLAPYSYVGYAGVGIPIQGDVLDVQFSDYNA
KVARTVAQTTFECIPDPCIALPCENGATCTQDMRDYTCECADGYTGDRCEVDIDECDGHA
CQNGATCVDEVGTYSCRCAAGFTGPLCEVNVDDCAGNPCLNGASCVDLIDGFSCTCALGF
EGERCEQNIDDCASDPCLNGGTCVDALASYSCECPDGFEGDRCEVNVDECADSPCVNGDC
RDGNNGFVCECDAGFTGELCDVDIDECASQPCQNNATCVDHINAYTCTCLPGFSGDACEV
DFCEQPENACENGGVCVREEERCECVDGWSGRLCTIPPQEIVTVTPPPASKSGSGNSVAQ
PAIFAVVGVIGVLACVVLVVVVRRYRASSYDTALDKSTLDWEGIDDVYDDSRHAGRNTYA
QSPIVPLDSEYENVPAEYRQDFSDSSVMQSRLGAELDTIASPVSLKQQQAADRQPATSGE
IIRSLQGQLEGADEAFQAVPRIKPTATFETAKSEENRPRNRYSDVLPYDDTRVKLYSSAE
TDYINGNHVSLQAGRRNYWYVATQGPVKGTLGDFWRMVWEQGSEMIVMVAAEVENGRTKC
ERYWPREQGDYDAIQYGDFRVTLLGEVANEAYALRGLRVKNMITGEKRSIRQLQYTAWPD
KSVPDDSNQFLKFVDEVAVTRDRLLNGNTAQPAWPTIVHCSAGVGRSGVLVLVEVALSLA
EQGLLPRLSTVLEEMREQRMLLVQTFPQFQFCHRAIIAHLQQQLQLEA
Download sequence
Identical sequences PTSG_08390T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]