SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08400T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08400T0
Domain Number 1 Region: 1072-1395
Classification Level Classification E-value
Superfamily NHL repeat 2.35e-33
Family NHL repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 465-535
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000639
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 3 Region: 391-452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000431
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 4 Region: 525-591
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000278
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 759-824
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000834
Family Complement control module/SCR domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08400T0
Sequence length 1397
Comment | PTSG_08400 | Salpingoeca rosetta NHL repeat-containing protein (1398 aa)
Sequence
MAGLVVQHLRLLLLACACLLALAGVSDGYVNCLDCYFRYVTPYGTGITSISSVFNSVYAD
RQWAFGYDQIGAFPTADVVGSGAFNYNQYTQSIAYYCPNQYYLITMESAVNNYYQDRVFH
WECRRSAYTYFRGCYTTGYLNGFTGSFNYNSGGRRVITGVRSYQDSTYITGYSLFGTPYY
HYSTFDRRWQVATCEIVCNLAFDYVNSGRRCITLTPTTIDTSYTYKFNIHGGFHAACPTG
QALVRMAAYSANEDRRWRFLCADNIGGPTDGNLVAFSQPTYNQLRAAFSYDCPPNSYIRA
VKSSYVFESLDRVYSFQCQYITGATLVDCVTVGPNAFDADTGFNAGTNRVFAGISTTFGA
SQNDRAFTYKLCRVSIVQCDDGFFYDGARGCIPLICPEISVQFGTVSGTCYGREGDQCSF
VSCDTGYRQIGDTTAITCNPDGSWSGSLPVCELDALGIVDVVGIRCPALSVVNGQVAGQC
DGLSVGDTCTLDACSSGYWPSNSGTTTVTCTEVDGELMWSGDLPTCEAVKCPPLKLNHGS
VGGQCSGNLGDTCYYNGCDNGFQIAIGGLNLRTCQQDGATGVWSGQQDRCDARLSATAQT
RPFSLMCDSGQGVVGLYSEYGSGYDRVNWDIICSDIGSNDSPRLWSKHEDVHQLQEDFSF
TCPDGTSYLAGMTTTYDATARDRLWEFRCATVFGAELVNCQQRTLYSYGVQFRAPDGHVV
VGVTSTYFATYRKRTFQYRTCEVRCRAKDEYFSTGGGECQRVGCGQLTIDNGQVAGTCDG
NIGDQCEYLQCDAGYQLSREGSAQRECKIIDGSATWTGAAKTCLLSTSTTPAAVTVDACS
VYNTAANPATCRSQCKYLKQGDATFSKTYGSCSNVCSCGCAKRFKLTKDAARCSAHCADQ
GLTGVYRDMHLGCRKVCLCVDGDAPTTPASGPLTQPPPDTSAFNFPYGDYNYELTFTGVV
GNNNDPRAFSTEFDFGASIANLEAESMLQCLRYCSADTNCKGLVVVVVNSMLRCQLLKNT
GTETGVVTDAPSVSLTRLASSTTSATTTTPAITKAIQTVVGNGGTTWDSSATLLNTGLNQ
PDCVTFDGEHEMLVTMVSDHRVIRVNLRTRTSSLVAGTGEMGASGVGGAATSAQLNRPRC
AIADIFGNVYITEEGNNRVSKVDVATKKLSVVVGTTGAAGHRGMGGTATAARINAPQSMA
WMDNGNLLFSDEENHVVYMYSPITTLITVVAGTPGAAGDDGDDGLAVSSKLNAPAGIAFA
DNTLYIADSGNHRVRAVDMRTGVITALAGTGVAGFRGDGGAPMAARLNTPRGIAAMPAGE
IAIADTGNSRIRTLNVGGQGAGVIETVAGTGARGFSGDGGVATEANLNFPTGITFSPSTN
NIVFVDRRNRRVRQIWS
Download sequence
Identical sequences PTSG_08400T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]