SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08401T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_08401T0
Domain Number - Region: 67-121
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00406
Family Complement control module/SCR domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08401T0
Sequence length 184
Comment | PTSG_08401 | Salpingoeca rosetta predicted protein (185 aa)
Sequence
MAVSFAATAAGIVTVLVLFTTAKVNATISYINNLDAPLSFRCGTGQGIYAVNSYHDNARE
DRSWAFSCMQYGTPQSGTFTTEVTGYVNAWDAPLDYQCNTNFFLSGANSYHDNHREDRRW
SFECTRIQGATLSGCSKTGYLNDWDQPLAFTPSDGFAVTGAFTGSPVFTTMAGKIAGGRC
TPAR
Download sequence
Identical sequences PTSG_08401T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]