SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08416T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08416T0
Domain Number 1 Region: 659-942
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 8.09e-65
Family Protein kinases, catalytic subunit 0.00000295
Further Details:      
 
Domain Number 2 Region: 1074-1176
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000346
Family SH2 domain 0.0034
Further Details:      
 
Weak hits

Sequence:  PTSG_08416T0
Domain Number - Region: 109-175
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000163
Family C-type lectin domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08416T0
Sequence length 1189
Comment | PTSG_08416 | Salpingoeca rosetta sek-3 (1190 aa)
Sequence
MLARSFSQVYKNEEPMCVEALGTSVNLQACPAGKEVVAFTSVQYGPGVSCASKVPSNVPT
GCPIQYPRDDVWAQSRAGGFVTAQTTLTPFASCEATSKLGVHYLCGNQPTAEDRKFEWRD
GKPYSFNINLWNTDEPNNYDFFTRVFYLISEDCIDFRFVNEKNKYLLNDTPCSELWKGFW
NSNARGVEASAGSYVCKRPTPTSPCHGGSCSSGDKCYEHSEQALCFWDCDTDKSASASIP
SSMGAIIGGAAGALFICIVVIVVLLVRRKRDKRPAPFDSETPVFHRQTYHNPIYSPDAVN
DTRHSMSGVPSPRVPAPYAGRTERSGSGSRAKLGRSSTRDYLNPLGSGNGYDNLTVDMEE
GEYDTARGDAGFADNPHYAQPHVFDGTYAMVGDGGDTDGTSATTPGYEEPHAAYLQPALY
GAVTSDGLDRDALNAQQQQQQQERRQRSSKSGPRRNPREDDAGVYYEPTFDVDDAHASVP
GFVRRLRNSGRRRSRKHKLHTPYLEPSVQPQQGAKKRDAARGYMQVASSSGKMPFAIPAD
EDEEADASGYAVPSVIQSQRNAGPSSGYIMPALGASSTDTDDTHVYSMAVAGIDGTAYAD
DDDDADNGAYARVGGGEDDDPITPGTSGYAEGPAEPLYVSPPTTYADIYSMMAQLTKEVP
AACVELEGVLGSGNFGVVRQGKLLSDSRARAKSSRNSKRQAQAVAVKMLADNTDAASRVC
FLQEAAIQAQFHHQNVVELVGMVIQSRPMMILLEVCEQGALKTLLRRSRRPRKWKMNAAY
DVSKGCAYLQSRGFVHRDLATRNVLVAKNGTCKIADFGLAREMLGSNSDYYRSSGGKIPF
RWTAPEALFYRKFSTASDVWAFACVLHEVFHDGEQPYVTMTNDQILDFLEEGRRLGPGDD
CPLEVYRLQMRCWHPSPESRPDFFDISQLLSVWVAHTDTLKECNASTEELQNMYANLPLD
TGVAKDLYGTLVGALQDDGDDYAYGFGCTTTDDADADVGAGVDASTGVAVAKANPQLQQQ
QQQQQQQQQAHSASMAPPPSSSPPSSSKAAADTPTFNTTPTSTTDTTPTSSSSTSDVDPP
YMFGMISRRRAEAVLRAQRKEGVKKPFLVRQKDARTYAISIGLRNKFVHHLLHCGNRVWT
FNNNAVPVQGSLRDVIEWLCERHPEHGWDVTLGQPLDRRAINMNAHPET
Download sequence
Identical sequences PTSG_08416T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]