SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08476T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08476T0
Domain Number 1 Region: 288-328,423-503
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000201
Family C-type lectin domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08476T0
Sequence length 807
Comment | PTSG_08476 | Salpingoeca rosetta predicted protein (808 aa)
Sequence
MLSPSLFGVSVVVVVVVVWGSAVCVGQSPDDYQVPNVNTKMDAVKDDIYSFFRPINSIHS
GAFRPTIDGTPVVYNGFRDHSVKAWFSWFGDELRAFVEVQDDVHLENLMVPRLGDVLRLK
LCGEGEPSCLEIMAIHQEDETVRASADPLGPLTEAHRESGLVLTMTVMDVDDTDYELVND
FGDTDPPLSIPRTRVSNIKLLFPESCGSAPIPEHVELIACIDTTTHTVFMLSGQANCDGT
SCREVCSDSDQLSYFSLNCWGNVWMGELACWDDTDIGPLLLLLEDDPFDVAQHECEIRGG
TLAWLDNFDEFTVAREYIELHNSPMQVGIGGVEVPAKTAAFGQELRCDTRRKDTVSLSCP
QGKSVAAIADVFIGKQQCDRSSRRARDGCIDVNDAIAKVWVSTVGKTAADYLTSSLSACG
DHVDVSVDYYCGSAVDPALREFVWPDGQAANVYEWFWQPYPDHKEPNNYEFRRKEPVTGQ
EDCLSLQLREGEYIMNDTPCSENFDGFWFTTTTTTTTTTTTTTTTTTTTTTTTSTTTTTT
TTTTTEKHKRVTSTQVLSYQPSPSPSSSLSQPTTTTTTTTTPTTTTTTPVLVTNPTASTV
ATIPSESTTTGTIKAVTTLPSVTSTTATTTTTTTVPPAATSSSSLSSSSSSLSTSQGQST
PSTATATAVVTSTAATTGTMAAASTASTTTTASGGSPEGSTQTAALQPWVFGAIAAGAAV
LLLVAVVFAASFYRNRGRVATQVESLPPAYGVATFMVENELYEGVTPVSRGPGDGHDTPT
AHMTPNDLYGAHDGHSPAHGDMPETTA
Download sequence
Identical sequences PTSG_08476T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]