SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08525T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08525T0
Domain Number 1 Region: 441-486
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000184
Family TNF receptor-like 0.017
Further Details:      
 
Weak hits

Sequence:  PTSG_08525T0
Domain Number - Region: 490-531
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0471
Family TNF receptor-like 0.0068
Further Details:      
 
Domain Number - Region: 158-220
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0915
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08525T0
Sequence length 684
Comment | PTSG_08525 | Salpingoeca rosetta predicted protein (685 aa)
Sequence
MCGGGVFAAAVVVACLSTAVTTASALQNATTTTVATTTSTTTAAACTLDSAPWYVVHSCN
GVLDGESCVAGCNLTARYTGTQTTLTCDNGSFNGNLPQCNPPCDATADLTPLLHTTCRSK
VAVGDGCLWSCVRGYEGPQVNRACVVVNDTVALQPQPPACSPVACTPPQDYDPERMDLSA
CEDSVHEDDCVAGCNEGYAGHPVTLQCDNGQLVGDLPQCILKRPTVKAEDGTLRFEVFDD
REAKLTYKTNLNEPNPWSGRLLTDVQVEDSIASAIAAIMDDPSARVRTEAQVRQIVTDAV
DGGGGVADAVQAVIDSNSPSGEPLVAYLEGAAASLETATTSLETAVNGRLGGLDSDVSTA
SGRLDSLEMSTVPSLMAFVDAKATATADSLRGELQDAISTQVQTLTDELSATNDQVADTA
DVVGGLETAVQNLMASNGALDRCFQRCPAGKYVSSWCTDTESNGCSSCPPFTYSPSSGLE
SACWPCAPSHCGVGTYMQPCEATQGISNCFTCPEGTYQDAGTHRETSCKSCTCSSGSYPL
STECIRTAPFECLPGGISVIASDDCPAGYWRMGGAESGCRTYPNYRNTFLHGGDHGSDYS
VTAVSTVKIAAGRYRFYCRSDDCCQIHIISGPTTFSPIDHGCGGCTSCNGHTADYNLPGG
TYRIQYYSHEYGGGAYYDFYFYRI
Download sequence
Identical sequences F2UJX9
PTSG_08525T0 XP_004990316.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]