SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08578T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08578T0
Domain Number 1 Region: 177-222
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000118
Family TNF receptor-like 0.0057
Further Details:      
 
Weak hits

Sequence:  PTSG_08578T0
Domain Number - Region: 161-341
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000942
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number - Region: 80-120
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00419
Family TNF receptor-like 0.0051
Further Details:      
 
Domain Number - Region: 20-62
Classification Level Classification E-value
Superfamily TNF receptor-like 0.011
Family TNF receptor-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08578T0
Sequence length 1473
Comment | PTSG_08578 | Salpingoeca rosetta conserved hypothetical protein (1474 aa)
Sequence
MQTTCKTCMNLNAYQPNSGQAGCIEFASCGRGKKFVTGTTTTPSTCVNCDAGTYQDQNGH
FDPDCKPCTGNTFTDQPGQQGCSAWSSCNQGQKWAAGSADADATCSSCTPGTYQNEFSHQ
HTSCKGCGAGTFQSGHGASGCDDWKTCGKGKKWATGTSTTDATCSPCGSFEFQSKSSHQD
TSCTSWSTCGPGYEVTIEPTASNDRLCAMCDYGHYQDDTNQMDCKPCDPGQHQDERGQIE
CKACGAGKYQGSSGQKDCIAYSTCDRGERWISGTKTKDSSCRSCDIGKYQNFLNHQRTSC
KTCPDGKYQLNTGRGSCPDCTTCEDGFEEVLPCTPTSDRTCTENDPPTIVLRRPDNNAVI
TNTYTVEAGLPFEPPIFTATDTAAGTVTKTPPPNLGDIDTSTVRSDQMLTYKATDANMNT
ATRTITVVVVDTTGPAITFDPAVLQLEAGEEVMRSNFTAGVSIVDRVDGTLGIDLLEYDA
SDVKVNKLGMYEVVYTLSASDSNNNEAPPTTRTAAVVDTLPPVITIGFGDREVSEHNVVI
HEAATEFIFPSQSAFDTFDTAVNGGDVRRNEEPTFHSVVDDGTQFTFTYTATDASGNTAT
VVYVIEVRDTIAPTITINGEHNITHEAGTEYVDAGATATDLLEDAIGRGVEVVVTNNVLS
KPPSVPAVFTVEYDACDKAGNCAKATRSVTVLDRTAPSIKLIGGSPLVVGAGSNFTDIDP
GVTLADLYYDNADLTLVIDEGSYLTTPTTAPVSFNVTYTVADPSRNTASVTRTITIIDTT
PPDLRVNGNLSVTVGDGVTWVEPGIARAYDNIDGDVRSRVVATTQLEEAGVVVPTMCAYS
SAREFVPPLSPCVWSSPRMDAVESRAPSGTVYRINYTVADAASNVAFVERVVRVADPSSP
LLRVNGRGVMTLEFSDDRGSFADPGATALDAHDGDLSGDVCVGVSIVTRDASGVVAPGDV
DGIGEAAINYVLSLARNASTTIAPPPATSTASTTTMNADTSNSNSSSSTAITTTAAGTTA
ADMFGLDAAVASAEVGTVYVLQYSVHDRAGNAAVGVQRAVVVVDTTPPEVTLYGAEEVHV
PYATRYVEAGYSAQDVHDGNITSQVVVSGADAIDVHVAGTNEVEYAVTDANGNTGVAVRT
VVVDGLTRPDGVNTVVRLVLAGTAESIFDGDVQQLERLLEEALNVEFVVVLSVEDGPAVV
LRPEQRRVMTTVVQFGVRNATSLAWESNTDAIGTLESRASLDKARIVDVHSANPQMQSAS
SSSSSSLTVLAGSVAGGLVLAVLLVIAAVVWRRRKRSRAELAMVSNIINATNPTFSPHSE
DTGDEVHAQHKWDAAVYDVSSPQFHHQQQAMGSQGSELSDSEHVYATPSLLPEVPRNPQQ
RGRVHSVHAWSTGLYDIEEEEEEDDDDEDTVSQPAGRGVSGSGSGRGDVGARRETLFAQR
MQAAREQQQRQQAQPTYDVVEAIGAHTEKHSET
Download sequence
Identical sequences PTSG_08578T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]