SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08599T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08599T0
Domain Number 1 Region: 359-401
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000113
Family TNF receptor-like 0.0056
Further Details:      
 
Domain Number 2 Region: 457-501
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000518
Family TNF receptor-like 0.0061
Further Details:      
 
Weak hits

Sequence:  PTSG_08599T0
Domain Number - Region: 443-630
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000157
Family Growth factor receptor domain 0.017
Further Details:      
 
Domain Number - Region: 228-272
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000247
Family TNF receptor-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08599T0
Sequence length 1751
Comment | PTSG_08599 | Salpingoeca rosetta conserved hypothetical protein (1752 aa)
Sequence
MSLDTSVKDLKLLTACFCSLCGLKDFEPACAEKSVCLCIKTKAECELVQPTTCCKSQEVT
CCLDCRSALPPDKEWRAVISSADEEPSNPKQQQQQQQQQQQQQNGASVLLSSAEGAANEG
GLALLLRGRGRRAVGEMCNTGGGGGGQDCAQDGSEVCQSGSCVCAAGYGYTGDDCVECGF
HFYKSSAGNEACSETIRCDKGERWFQASSSDQATCPGCQFGKYQDKTGHRNEDCYDYSTC
EAGKYVTQEPNTKQDRECGLCEPGKYTALTNQPSCRNCPGGKYQNEEGQSGKYQDETGHQ
EKSCKGCPTGEFQPGSGASSCEAWKTCGQGEKWISGSTTEDASCLPCGSQEYQSKTSHQD
TSCDAWTTCSSGYYVTADPTSSSDRTCDKCDAGTFSDTMNADNCKSCGAGKYQDASGQTD
CKDWTMCSQGEKWTTGSSTEDATCSPCSTLHYQSKTSHQDTSCTSWSTCGPGYEVTTEPT
ASNDRLCAMCDYGHYQDGTNQQDCKPCDPGQHQDERGQTECKACGAGKYQGSSGEKGAGQ
GGAGDELHQWRYCITYSTCDAGTKFVTGTTMEDRTCELCEAGKFRADTGHRLTECEACAD
DTFQSDEGQSSCMVCNECDPGYINDQDCTPTSDRTCKDIAKPIIVLRRPDNKEEIQDTYV
VEATFAFDPPIFTATDTAAGTVTKTPPPNIDDIDTSTVGSDQMLTYTATDANMNTATRDI
TVEVVDTTGPAITFDPAVLQLEAGEEVMRSNFTAGVSIVDRVDGPLGIDLLEYDASDVNV
NTLGMYEVVYTLSAPDSNNNEAPPTTRTAAVVDTLPPVITIGFGDRNVSEHNVVIHEAAT
EFIFPSQSAFDTFDTAVNGGDVRRNEEPTFHSVVDDGTQFTFTYTATDASGNTATVVYVI
EVRDTIAPTITINGEHNITHKAGTEYVDAGATATDLLEDAIGRGVEVVVTNNVDTTPASA
AEAVFTVEYDACDKAGNCAKATRYVTVSDPNAPNIELIGDSPLVVEAGSNFSNIDPGTSV
SSPVFNSANLTVFVDDGGYMSTPAVTPATFTVTYTVTDPVHRHKSVERTVIVIDTTPPDL
RVNGGLDVTVGDGVTWVEPGVARAYDNIDGDVRSRVVATTRLEEAGVVVPTVCAYSSARE
FVPPLSPRVWSSPQMDAVESRAPSGTVYHINYTVADAASNVAFVERVVRVADPSSPLLRV
NGRGVMTLEFGDDRGSFADPGATALDAHDGDLSGDVCVGVSIVTRDASGVVAPGDVGGIG
EAAINYVLSLARNASTTPAPPPATFTASTTPMTADTSNNSSSSSSTATTTTAAGTTAVDM
FGLDAAVASAEVGTVYVLQYSVHDRAGNAAVGVQRAVVVVDTTPPEVTLYGAEEVHVLYA
TRYVEAGYSAQDVHDGNVTSQVVVSGADAIDVHVAGTYEVEYAVTDANGNTGVAVRTVVV
DALTRPDGVNTVVRLVLAGTAESIFGGEVQQLESDLEEALNVEFVVVLSVEDDEVVTLDD
GSMASTTVVQFGVRDPHSLEWADVSALVMSLMQNSAAGFRVLEAHVIQVASAATTTTTSP
ASSSSSSVSVPVIALALFCCVLLVALLVALVMLRRERGGKARLAAADSSFTTLNPTFSTS
PAHDPSSAYEVPVPRHASSTSSSPRSSSNNPEAESGTQQPKAMHVWAHDVYDMEAGERTH
PPERRSTDVSALPPKPPRVSRRGISSTGVVVSPRRALRAHPPPPSPAASTSSSSRAPIYE
TVERVGGASEA
Download sequence
Identical sequences PTSG_08599T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]