SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08677T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08677T0
Domain Number 1 Region: 4046-4141
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000000012
Family SH2 domain 0.0042
Further Details:      
 
Domain Number 2 Region: 31-111
Classification Level Classification E-value
Superfamily E set domains 0.000000000586
Family E-set domains of sugar-utilizing enzymes 0.025
Further Details:      
 
Domain Number 3 Region: 2950-3215
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.00000000652
Family Galacturonase 0.079
Further Details:      
 
Domain Number 4 Region: 1870-1963
Classification Level Classification E-value
Superfamily E set domains 0.000000014
Family Other IPT/TIG domains 0.059
Further Details:      
 
Domain Number 5 Region: 863-933
Classification Level Classification E-value
Superfamily E set domains 0.0000000242
Family E-set domains of sugar-utilizing enzymes 0.0094
Further Details:      
 
Domain Number 6 Region: 244-305
Classification Level Classification E-value
Superfamily E set domains 0.0000000518
Family E-set domains of sugar-utilizing enzymes 0.033
Further Details:      
 
Domain Number 7 Region: 1183-1279
Classification Level Classification E-value
Superfamily E set domains 0.000000123
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number 8 Region: 1603-1662
Classification Level Classification E-value
Superfamily E set domains 0.000000522
Family E-set domains of sugar-utilizing enzymes 0.053
Further Details:      
 
Domain Number 9 Region: 1494-1590
Classification Level Classification E-value
Superfamily E set domains 0.0000105
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.083
Further Details:      
 
Domain Number 10 Region: 741-766,811-848
Classification Level Classification E-value
Superfamily E set domains 0.0000787
Family E-set domains of sugar-utilizing enzymes 0.035
Further Details:      
 
Weak hits

Sequence:  PTSG_08677T0
Domain Number - Region: 2188-2350
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000111
Family Pectin lyase 0.018
Further Details:      
 
Domain Number - Region: 1363-1427
Classification Level Classification E-value
Superfamily E set domains 0.000126
Family E-set domains of sugar-utilizing enzymes 0.039
Further Details:      
 
Domain Number - Region: 367-432
Classification Level Classification E-value
Superfamily Anthrax protective antigen 0.000366
Family Anthrax protective antigen 0.041
Further Details:      
 
Domain Number - Region: 1079-1143
Classification Level Classification E-value
Superfamily E set domains 0.000518
Family E-set domains of sugar-utilizing enzymes 0.038
Further Details:      
 
Domain Number - Region: 1686-1795
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.000709
Family Galactose-binding domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08677T0
Sequence length 4271
Comment | PTSG_08677 | Salpingoeca rosetta conserved hypothetical protein (4272 aa)
Sequence
MLVASLLAAGLALLLCVAVPPASAVLSARATITEVFPRYGSLEGGGSEVGTYVTIRGAGF
ARGGAQGTTTVYIGNTICKTIEYYTTDTQIVCVSKPHPQGTVSVQVELISIDNAHYADCR
TSCSFRFHWDQTPYLREITRSTVPGGDIMMEGYFRGRTYADNDVRLSGSLCSFYDEEDEV
LVARTWYSARTTCRLADDIRAGRYNLTLTASNPNSVYSFGYQSNDDSLWAVDVDGGKPYT
VTVHPQVSHISHSSSGLLGGYIITITGSGFDDDNCNANKVLVAGVPCIITTCERTTLTCE
LQPFAANPQAHHTPTGLNLRAWNGNQPWPFTAPQLGAPDLEMTQMAALQGLVQIDSFPRY
ASEIVAYFVPPITGNYTFYVRSDDQGSLELSTDEDPANARRIVHIGSYSSHFYVRDGQIS
DPVPLIAGQRYFTRVQQRDGGGGDFVFVACSIRPQDPRNLTVYQKMHESVRERQSVRFST
IVTREEHTITITGATGGSFYLYGQNTLSRQVNWDSPSSTMAYAISDTSPCSSIGAWVQDT
VEPSTNETVRTYRIRYNCPTETEFALPQVIETSTAQLTGKTASFSIDTQRTVAASDPIRG
TFRVGYHNLWTDWLDWSASADTIADQLEQYTTLTDLRVQQTHNIHDGRRISFTFYTPTGN
TDLLMVDDSRLEGTNASMSVVVEQEGVHDLMLDPIPGEHFQRVYTNVNSSVRVFVDDVPA
GCDDVGTGDSVCAFTYNDDITPVITAVAAPPTAYNGDTVSIWGRNFATVNTANDVINNTT
TSEDGAAANATTTTTTDSALAVGVAVFMGVDGPACNVTFVNSTYIECTLAHGAAGAHHMD
VVVDGQGRARDDANTTINYGFRIDSITPTSSGVAGGRLVTIRGTGFSDTSDDAVLFGGAA
AMVVASAHDHAVCVVPHLSSDDGSLTLAQGKAALVNTTTVDVNITVNGAAVPAVSFTYDW
DATTAITHVYPSQIPSAVSTYLVFDGAFPTPGELVSNSSMCSPVMGTKAATVFLAGHREC
ADAQVTDDGAHLTCLVVRGDALPITQQVDQVPEMRFCTADGIVLARPEPAVRVDVAHRVS
AVSPSAVGMNGGSVVEIHGQGFGTLLSSAGVLIKDENGTAVTACRVFNVTNTLVQCTLDA
TDTPVEGGVLELQVNGFVAKCDVPPPGSTQPTSACDFSILPALTPVITGASNTTGGEGTL
LHLQGYRFQFSAEDLMSFEHVGADNLTLAPHVTVGYGHCHVVDYTQHDIWCMVPALTAGN
HSIAVMVPPVGTATVNLHYHHHHMDMDMDMDMGMADNTTTTTTTTTTMVNATLAVNATMA
MNTTTTTTTTTSTTTTTTTTTTTTTTFDDVATTHAGHLMFSYPLTVSHMEPRTGSIAGGA
RVTLFGDGFNPHDAVQGNWVLLDNTRALVVDATYGSVTFITPTLQQTSIADTQTASLTVL
VEPYGGDSDHDHDHGSSSDTTSSTTFGASTNLRTYSDCPVPELCQFAYNMSQSGNLASVS
PTQGVADGSLTLTLTGTGLLGGFDPTPYVNATNATVTPTWPTNIAISVAGVPCEINQTAS
TDTQVECLLGRVPAGTHQVLVDVSPFGVVRGAKAFTSLLQLDDVAPELASYGGGTHVTLR
GRGFGLDTKRSVVTVCDRPCTVISSSYDTAVCEAPSINTPESYEAFNNVEQQVLSGTPTG
YGAVGVASVFDDDFLTHSWSYSGYRSTCSILYDLGEASVASLHRIRYFPRLQYRTKAAGG
TFHVSLDGVNFTQVATISQETTEGWTSIDLDEPTGYIRYVRYNGPVDGYCTMAELEYIGI
YMSTLDANNACAVSVGVHPPQPHASMGHVARDTNHALVMATATATSASASSLPVSVDGNA
NQTLAYGIAATPVITSVEPKFGSSLGGTLVTLTGARLPTSSQVNDTTAMVNGYPCLVRDA
AADGTWVTCETTKRSALNPLSLELRTPAGHSAVSESTVRFRYLDRWSQVNTWANDEPPVD
GDTVVIPPDQVVLLDVSPPKMYLLLVQGELVFDRRDIDVHASYIWVQGGKFEIGTEEDPF
LNRATITLYGDRFNSAGIPHIGAKVLAASDNTEESAHHHGTGHVVAWRDRGVLDLHGRPR
VRTWTKVESTVHAGDDRIHLSEQVDFEDGEDIILTHHSAMRNTEELVVAGLEDDGYTIVL
RDPVRHTHESAIHYIAGERIDMRVEVGIISRNIVVQGEPGKSEKQRFGSHLIGAHGALLR
VENIEIRRCGQAGVLGRYCSHFHVAGDNRDSYIRSNSIHHSFQRAVTVHATHRSLVQNNV
AYHVKGHNFFVEDGNEQFNVIEANLGVFTQRLFVMLKSDTKPATFWMASPANHWRHNVAA
GCDNDGYWFEPPTHPGGPSFTTSICPVHWHMREFFNNTAHSNGVHGLRIYPSYVPFVDPC
DSTSGPAPQYFHNFTSFYNGAHGIFGKQNGDLHHVNAKLVGNGQEELFWKKFIGIEYRED
DPNIVNSLFVNSVSLPAKKKTLSAIMMPQNEFFHVDGATFVNYEDAGAISGCASCGSDTD
YRQGGYTFRLANVRFVNTQRYVRWTVPFKQIFHDLDGSLTGFVNGTATPYYAWNHYPGLC
DHKDAVYDEGIVCNGDVRVRRLQIDGINPDELDFASVQFSQRDHPNTTEDTLVFRPKEFY
GYAVPIVNQHSYFASLVSMIDFRTMRIRYSEPEYLRGSKEYLELMWSYIDYRWAFEVIYN
NGEERPAASLITDLSVTDPFGTGKIDHNRQLWHVALTTSGIDHTIPGTIGSGGPYVVDVS
AIQCAPGACNDLFSTEPLYDPTYWSDISMWCRVPSEQKASYGRFGDGFAPCEGITAYPEA
GDNIVINSRMYVVLDMDPPRIGNLQIIGKLEFKDDADRTLEADTIEVWGSLQVGSKGRPF
SHQAVIRLHGERTSPTLVVHNSRFLGNKVLAVLGDLQLHGLPPDVAWTRLAMTAEAGDTT
LDMMEAVDWAQGDRIVLSATEYNADAYETAEIAGVSADGLTVTLTAPLQHRHFADFVESG
RGDVELRAAVGKLSRNVRFEGATGAGEGGDTYGAHIVVMDAAFEQGTRVGTSSITGVEMN
SCGQEGMEHACILYVYDETFAAGDEPINEVLFSTMSDSHNYGVVSEGSQGVTLHDNVIHH
TQRDGIELDTETQRADIRRNLIVGNHRSPDETDTWVRPHAAIFADTASVVLEGNVVSGGE
DAGFVVRADACDSTEPRIIDNEAHGVLIGMFVIAESRGCLAVNRFKAWKAAHVGILTVDQ
RSHFEVHESVVADSHIGISANFFNPALHTRAEVVSCIIMGSTPASTCDASLRCRAASKLD
VAATSGTCNSVFGNTYRRVGLLLPQVTNRGKTCGQDDLPVCRPITTPERLCSMGWERRYG
LPGTQHTELRVVDTDFSHFNSTDCGLKSVGISPNPTQRNYSPEQYYEGITWHNTAPDARF
YFAPTGIFQHQCNTGCDAVHLMVAHDLDGSLSGMGRAGVVTSEANPGLIDGHSRCTTMGD
AGAFFCHSMPLRTATFENIDRDRGSRRIGPIKMERMFNETVVERQHFSLGPFDDGCAKRF
FFGQYPMVFETGRTYRLNTSNTLPNNARIRFHSTDPADKVLLRIYVYKDNLALRVVNGGQ
EIEPLQRIPTLADPRGANAYDARNTYYLVLQGSPSAAEQIYDIRTINKVQLNLTLSVSVD
EFHTNRAALVDNLAVLLNIPSWRIKVVSVHEVNLESAREEALRKRLAEESSRRRRATSDT
GVDVEIEILDANNGTVAKTDEESEQQLEELNTVVETFAAVASTGALKTTLQDAGIPLEAV
AIQPPAGNGVSAQTSFSVAITTTTTTTTTTTATTTGDTVTTTGNLNPNNDKSKVEQAVAV
GTGVGAGVLLVVAVVAVVVTRQKRAAKRARSPVIKLDVEGYTGNNSSNIAGVGTAMRTMD
EPEKESPFFVTKMNMRPASSNVSHEVEVEDLERSGVAGPNADSINEEPAAQGRRPSLFAR
LANSVRHASLTGGSGDGNEKSPKVKRIRSRRGLNPLQSTYIGGKQTSVREDIKLKSLRKV
SGPSVSDRVEQFHRSRCRVVSRLTWEYVHMHDWYHPTIGSDAAQRIVRDKPIGTFLVYGR
LHCFLCVRVASSIVRHDALEFNKDKGYRLHLLDQPQPWFPDLATLVGHYQEQRPHVPFVL
LPEDQNDVHFTLPSPTSRVTTTEEQELAEPQYNSEDLNRLSRRISKRVRKRSSQLQDESV
RLDPAAYPAREPRGSLRTRAALEAFEPLLINEDGAEVDGANDVDALIAAADGQASSQTHG
AKGSSVAHNLI
Download sequence
Identical sequences PTSG_08677T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]