SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08713T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08713T0
Domain Number 1 Region: 28-125
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000149
Family Synaptotagmin-like (S variant) 0.033
Further Details:      
 
Domain Number 2 Region: 332-389
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000133
Family EGF-type module 0.038
Further Details:      
 
Domain Number 3 Region: 421-481
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000576
Family EGF-type module 0.052
Further Details:      
 
Domain Number 4 Region: 243-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000329
Family EGF-type module 0.015
Further Details:      
 
Weak hits

Sequence:  PTSG_08713T0
Domain Number - Region: 466-520
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.03
Further Details:      
 
Domain Number - Region: 379-412
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00397
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08713T0
Sequence length 1028
Comment | PTSG_08713 | Salpingoeca rosetta conserved hypothetical protein (1029 aa)
Sequence
MRQQGVTIVALTALAVVLVCGIRCVEAGRVRVYAKSASVPSHVDYFSDADVYVRFRVEGV
TDYIKTREIESNSPTWNQWLDFGRTDIRPSGTVRVQMWDGDFFGGDLIAEDTFDFSFSGC
NKQTTSYTLRQAAYTTVWSFNIRIKIGTTTFDFTLEYTPTNLCSTSYCDATSTTCSCRSD
NSATCSCKSGYTYVDARRCKERNICTNNVKGCDLSSTTCRKTGPGTAECDCKSGYRRRTS
TSCAAINPCSDNPNICGRNSQCSMTGPGTYRCTCEDGYSSSTADNKNCRPIDRCELNTDT
CDGNNTICEYVGPNRFKCTPCPDGHKATDDECMQINPCMENEGICGDNATCEFAGPGKYT
CLCASGYEHDSPTDKCTPINRCEQTPGPCGDNSKCSPTGPGTYTCLCEQGYESDDSAQTN
CSPINPCDTNNGGCGSNSQCDHTGPGTRRCTCDAGFRSTSNDGANCVEIDPCVTDNGGCG
NASTTLCMKTGPNERECSCRDGFTSETGRDCIWINPCVNEDYGGCLQATEICMNTGPNEN
KCDCRTGFEFDEETGHCQCGDRPACPEFSACQDSSCVCEGGLRLVETDVGDLACAPTTTT
TTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTPTTTITTTTTTTTTTTTTTSTS
ASPIVVTTTPYTAAAGTTTTTTAAIGTTGRHHKQAQPTSTTSTSAVFTIAPPNRQRSSTS
SAADPVVIGAGIGGALVGCALLISVVVLFVRRRRGRHDGHHDTTTTAPPSHPPVYGRGVP
PPLASMSTTNPLFVGDAMMEPAGMQPAWLPEEDATAFDLDPSNHYDNLQEDDASNVADNC
YDSVQPADDQRTYLTPGQSKQHAPAYHVPNVMGGGGPTQHTRNRDYEQPTSTQQHCYDSL
QPEYSSSSSSNHCHHHYDFVAAQPEYDNPGTIYDVAESFVQVQNENGYAQLQGPFATYAA
TQRQQGQHPRSDVVYDVASPSFTERPTHHHQHHLYDVGSDTGAGPRRVRSISSSETAPIY
DMASDSHA
Download sequence
Identical sequences F2UKG9
PTSG_08713T0 XP_004990506.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]