SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08822T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08822T0
Domain Number 1 Region: 1244-1345
Classification Level Classification E-value
Superfamily Chaperone J-domain 1.2e-24
Family Chaperone J-domain 0.00033
Further Details:      
 
Domain Number 2 Region: 1152-1281
Classification Level Classification E-value
Superfamily TPR-like 0.0000000126
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 
Domain Number 3 Region: 1058-1146
Classification Level Classification E-value
Superfamily TPR-like 0.000000678
Family Tetratricopeptide repeat (TPR) 0.028
Further Details:      
 
Weak hits

Sequence:  PTSG_08822T0
Domain Number - Region: 478-507
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0126
Family EGF-type module 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08822T0
Sequence length 1436
Comment | PTSG_08822 | Salpingoeca rosetta predicted protein (1437 aa)
Sequence
MTGLGFQQRSYGCTAACGLACKQPITAECSCILVTWTVQISGGHCSPNQKTSTRSSCGWK
TRLRVSPSTQQRFYIFKTSFAERGGMVKGYAIQSLQYPHLCLDGNMRATLSTALRLAPCQ
DSAFQVFHGDMLALLAQPAEARVKPSVVDAPSSSQTRAATSKEAAHIERVEELRAKLKQR
QQQQGQEHKRQRRSSTHTSASSSQRQDVLRVFADSEWRGRSSGFSCCGKHRLRQPVHSIL
LKPGYHAVLYGGWKCDEVLADLAGSTNNASTFTNGAQVQCLQALALQPSVHLPSKSAPSS
VSAFSEEDFQGREIKLPTIAAPNIYQTPIASLFHFHEDPSTSDTIASLRIPAGSRVFLHH
GDRQAGGRLLVRDVRGGLEPSEFTHASITWMPWSQLRGVVFCPRPLYHGHCQYYTLGLYD
VPAEGLGSIFIARPGYRVKLLNKDSRLITAIDNNTTDTSHVFELEKQRPASFLVGFACEN
DCNKHGRCIGANVCTCHKGWKGEFCQYGPPDFTSVIVCDSNTAVAGSPLHCIIRPRHAGL
PTAASGSDFQLQPDLDAITHVSLRMLPPPAVNLGTGASHDDNSSNSSDEIDALSERDIHF
EVTANHSTSGHERLFTAVVVTPLLPQRQSGGDGGEGEEGGDEGDDHELDVLNTPVIAVFP
RWSSTDVQVSCGQPVHSLLDATRRYDCILTTAPRGVYTVDDDGECGSSDKHNAGGPPKRA
SADDEHTDAGTSICVPTVLDALSCRIEDGGAKAAAPPLSSSSSSFAVSMHASNADAVGCS
FKFSIDVMEDGNPDDDDAPDGTDEVEMDRVSSNADNIDGGDSADDAAVLVCGYVYRSGQH
RSNSDESSSSSSSSSDGDNSNGSRGGSSGQAHIDDVSFEDRLIALSVGRLLEEEKQAHVL
SRDVTRQLAHVHALLRAYEFDGAVALLRYMLLSLERNPVAALMANAQPQYQQQPQQQSAK
AVAIVQQVQLTLNLLLLDVLGKVGRFQEALLASNELRQLLALWGETPSRTTHAQVSALEA
RASRGLEVLQTLTDMLSSSGDVDESATDMCSPATITALSAVLVDAPASATYRRWRAECHL
RHGNASAALADASMLVRLDKADARTLRLHGAIHWRLLGNTEVAATVLAKCIRISTPDAGA
RQLCKREEQMMRRVLSLAAEAKQFKDQREFLRAIHAFDTLLALDAHSEMALTALQELCEL
HFFVNRIDAALHSCTRALEDVRLQENSQFVVHLLMYRAWAFLTKEMFSNALRDVKRARRI
SPHDMKLLVLQRKIELAVKEATTKDYYSILGVPKGASTAVIRRAYRRLVRVWHPDKNKHP
DAEQKFLDIVEAYEVLMDDELRAAYDKGVDITEYMERRKRSQQQEQEQDSSADETDSSSH
GRGKQQGQQQREDDASDDDDDDGSSQQRQQQRSKRSRQATRDITLPQHCCITHQED
Download sequence
Identical sequences PTSG_08822T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]