SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08827T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08827T0
Domain Number 1 Region: 35-519
Classification Level Classification E-value
Superfamily (Trans)glycosidases 9.24e-120
Family Amylase, catalytic domain 0.000000179
Further Details:      
 
Weak hits

Sequence:  PTSG_08827T0
Domain Number - Region: 535-587
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.00768
Family alpha-Amylases, C-terminal beta-sheet domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08827T0
Sequence length 666
Comment | PTSG_08827 | Salpingoeca rosetta alpha amylase (667 aa)
Sequence
MKVTAATAAIVATAVVVLAAVCAASPTAAASPADGQWWQTGIVYQIYPRSFLDACSPNCT
GTGSLRGIERKLQYLRDTVGVNAIWISPIYESPMADFGYDISNYTAIWPTFGTMEDFDNL
IAAAKKLGIHVLMDFVPNHTSNQHPWFLASRSNKTNPYRDWYVWRQGRIGKDSEKLPPNN
WRTIFCPDANCYGWTYDNATDEWYYHCFLTQQPDLNWTNPDVVSAMHDVLRFWLRKGVDG
FRVDAFPNILEDPQFRDEPLNPNWHGDPVTQGYEKLIHIYTENQPGLHDIVRGMRKVVQE
FGDDKALIGEIYPDNVITEEDVISFYGTEEEPEFSMPFNMNLISFFDYAAAFDPTVHNNP
RNASRLREIVDHYNASLPAWAQPNFVLGNHDVRRLASRLNDTALTRVANTLLFTLRGTPT
MYNGDEFGQKDGYVPPGRRQDPNCKTNYTGLRCRDPERTPLQWDTSNANAGFSGAGVETW
LPVSSDYVHTNAAAQMGDPTSMLDLVSRVIALRTREHALHSGLYQSLDVVVTPAHLTDNV
FAFLRYNESNTAYVVVANLADHPVRVQVIPPFDVIQRSVAHIDTFNSSVVNSTVNLSFLH
LHRAHAQVVAVRYHNESTKNTTVGVVVAALLGTVFMVAVVAVYCKFGRAKDTGYAYTAVP
DVIDER
Download sequence
Identical sequences F2UKT9
XP_004990214.1.12839 PTSG_08827T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]