SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08941T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08941T0
Domain Number 1 Region: 434-580
Classification Level Classification E-value
Superfamily C-type lectin-like 4.81e-27
Family C-type lectin domain 0.0036
Further Details:      
 
Domain Number 2 Region: 579-721
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-21
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 3 Region: 324-420
Classification Level Classification E-value
Superfamily C-type lectin-like 1.24e-16
Family C-type lectin domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08941T0
Sequence length 722
Comment | PTSG_08941 | Salpingoeca rosetta predicted protein (723 aa)
Sequence
MSCSIGACAVRRLPLLAVAMALAVAAVSAQGCPGDVFPGNGDSDTPADIAPAPSTTFTGV
VCKDEDDWFELQVCKGCTVEVEVTFQNAQGDIDAVIYAADGTPSDTSTSESDDESLTHSN
TLDETSHLLHIYLYQPIFEDTETPSNDGPTSYQITINITEATTTTTAVPATTTSSTSFIS
SWFPCFYDPYEPSDTRETAYAITSVPSQLLAEACPEDRDWYAFELCPGCTIDVSVAFQGL
AGTPALALYHGASGSTPLTSSDDRIYQGSYTAPGSGSGSATTVYINVYHTRYIPVDYELA
ITVNEGSTTTSEPTTTTEFTGSVTPFPGPTSGWVAFQGSEYNVYDEDKMHHGDAEAFCQS
EGGHLAVVTSLHEHVWLTGFAIARTDNNEAWIGGIFPEPQELQWIDGTPVVDFGLPWKEG
TTTTTEFTGSVTPFPGPTSGWVAFQGSEYNVYDEDKMRHSEAQTFCFEQGGHLAVVTSLH
EHVWLTGFAIARTDNNEAWIGGIFPEPQELQWIDGTPVVDFGLPWKEGEPSDNRQAGCLL
HNLRNSDGDVTGLWEALRCSRRRGFICERPSDETTTTTTTTTRSGSTTTTTTTEQMWTQF
TDHYEYRIVSTAMVEFGEAEDQCIQYGAEITSVSSQSQLTWLTQLATNNTNHPSIWLGGR
FELAWSDGTPVVDFGFPWLSNEGEGKRVERCLYMLLTGTNTGRWADGLCNERRPYICRRP
IE
Download sequence
Identical sequences PTSG_08941T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]