SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08964T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08964T0
Domain Number 1 Region: 152-260
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-20
Family Cadherin 0.0008
Further Details:      
 
Domain Number 2 Region: 57-152
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-19
Family Cadherin 0.0014
Further Details:      
 
Domain Number 3 Region: 363-471
Classification Level Classification E-value
Superfamily Cadherin-like 8.99e-19
Family Cadherin 0.0034
Further Details:      
 
Domain Number 4 Region: 256-372
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-17
Family Cadherin 0.0051
Further Details:      
 
Domain Number 5 Region: 659-931
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0000000942
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.022
Further Details:      
 
Domain Number 6 Region: 474-576
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000518
Family Cadherin 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08964T0
Sequence length 996
Comment | PTSG_08964 | Salpingoeca rosetta predicted protein (997 aa)
Sequence
MHDEHTHHRNNKNNMHHHRRAVSAVFLCFSRLLLLLLLLLLLLLLSAFPHSVRASNQAPQ
FAVDPFQFSVSENSPQGTVVGHVSASDPDNDDIVLSLVSTDTFSINPAGDVMLTSTLDAE
TRARYEFTVQATDSNALTSNAQVIVLVTDVNERPSFTANMYTRTVREDAAVGTAVVTVDA
MDPDTSSTNNQLSFSIDSITAASEQQLFVLNQTTATSAVLLLNKALDFETSPSHTVTVRV
TDSGSPRLSATVDVDVIVLDANDAPVATSPVVEVLLEENANINTILHVFAVSDPDAGQSL
SFTIDPSTDPTNAFAMDSNALIVADTVDAEMLPPTFDLRVIVSDNGSPPLNATITVRVHL
HDVNDNTPMWDLGTNQLNVSENLAVGSVVTALRVSDGDKSAANSGVTVAINAGNEDDTFA
LVTNADNETLLVLRKPLDYERTSVYSLALTAEDTGDPPLSRRTSLTIRVLNVNEAPVFLR
SAYHASATSHVAVGTPLLPIAITDPDGNDVLVLRVENVLFKPPGVGGAVVSASGALHIEA
SSVTVTTGRRLQAGTYTAVITATGGLITTAPLTIHIEQAPLREVHMTEDVEGNLYIRTAT
QGQRILVNGVDVVKGVTRTAATLNAITRYRCRHGALSHTFPTNLNEGLEDGIAWDTAVLA
PDGLVYAIPSVASAVAIIDPATFTVDTTTMAEFDGSAGTLRWAGAVLTQDERRIVAVPTM
AEGVLVIDPWARTHDVHAVARSGANDMWRGAVLVGDGRVCGLPWRGGYLLLFDPTTNTTD
ATSVAVPLENDGHRAWLGGVLAGNGLAYAPPFRATSVLVIDAAKDEVRTLPVPLYTEDDD
RKKWSSAVLAGNGKVYCVPATGVPVVLIIDPHTDAIDTTTISTVPALPSILWSRAVLSSK
GYIHVLPSDGDTVLVIDPNRNTIDYTSMGGLGNITANAVWKTTVAIPSADDNGGGGGGGG
GSGGGVLALSGDGATALFVDTHTCMEVLETGSGKGG
Download sequence
Identical sequences F2ULT7
PTSG_08964T0 XP_004989762.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]