SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08988T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08988T0
Domain Number 1 Region: 189-255,326-394
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.88e-16
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 
Domain Number 2 Region: 928-996
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000032
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 1099-1165
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000431
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1300-1359
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000834
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 5 Region: 1038-1110
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000222
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 6 Region: 1156-1214
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000306
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Weak hits

Sequence:  PTSG_08988T0
Domain Number - Region: 1197-1336
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00124
Family Growth factor receptor domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_08988T0
Sequence length 2020
Comment | PTSG_08988 | Salpingoeca rosetta conserved hypothetical protein (2021 aa)
Sequence
MTSPLSSSTAHGSAPDQAQKLGEAPAADVPVDTTTTTTTTTTTTTTTTTTTTTTTTTTTT
TTTTTTTTTTNTDTDTTTTDTDEPVPLSFGDFFTGDRDVFFDSVYQHETLIDHRPTPDAF
TPRLRQITTPLNQVQSLCHAFEQQDKQSGGFHIKEQGETRQVSSCKQMEDELAAGAGLLI
RYEDLVDSPAQDHVKQLQDGVRDVFGTESTVHLYHATQNESRALMPHTDPYDVLVIQLHG
SKRWTTCIPDAYVSDTDTNNDGSGTNAEDDDNANTGTGDHGAFASASASSSSFPSRHGTR
ARPSEAETIKHFNPAQLGQLQEIRRQRQQGCTAYQDADLRGMRCNEFTLRAGDTMYMPKG
IIHFALSGEEGSSHLTISLERKGLAWADALMHAGLSGSDIVDNPAFLGHWKNTVQSLISD
YRGVQLLEAMPSWHLNTGALCAARGQEQQQQQQQHDNGSAAGGERDEVKAFVASFQSLCR
EVGPDVLETYTKANDLDAFLNADGIGALVERVCSEESAAAVVEQLCARGKMPVDVTSPRF
RKMRVPQMERVRRATVTAAYTCNTGCDESCDTSSCNLGCDGGCTGGCDDSCTSCDTGCDI
CYSGCNTGCDVTTCTGSCDTGCDICTTGCDSLCDDSCNTGCDTGCNLSCDLGCDTGCNTG
CDSSCDSSCDSSCDFFGWSCDSGCDGSCDYQCSCDICYSSCDTSCDLSCDDSCTSGCDYG
CDTCTTGCDDSCTSGCDGSCDGGCNLGCDDSCDSSCTQSSCDTGCTTNCNGGCDTGCDGP
CNTGCDDNCNTSCDECTYSSCDSSCDGSCSCNPGYYGSGTSCTACGPDTYSASSGQSSCT
PCGSCGSNQYRVNCGGSNDGSCTSCGSCPAGSERTGCSGTSAGTCSPCDSRTYKTSQDNQ
PCSPCGSCAAGYYLAGCGGSSAGECVGVQCNTPPSVSHGSVSSLSNNGRYPSTATYTCAP
GYMLASSSDNKLQCQTDKTWAGTMPRCIGVPCPGISIAHGSVSPVFVQHWVVLMGATSAQ
CQANGTVVVAAPTCVGRLCTLLDTPNHGSVSYTNSRQYPSTATYTCQAGYELSDTGDAQR
SCIASSGGFGGTAPSCVGVLCKPLSDPQNGHLRLSSTPARYPATAEFSCVPGYELVGQAQ
LSCKTDKTWSAPAPTCRGVLCTAPSIDHAQVSATSGRYPADASVTCAPGYGLVGAPTLSC
RTDGTWGELPSCQLCPANSYAPSPTQPCASCPSGTSTNGQTGATKCECIAGHEPSGDGST
CVPCQANHFKPDFGSVSCQPCQSGFQTENGDFTRCVGVPCDPVRDIENGDPENTMMHRYP
ATVSYECDTGFQLVGDVSSITCQTDGTWSALPSCTYICGDGLVVDGEECDDGNTDDGDGC
SSTCQLEDTHACVDPGEACVYCNFTSRPERLVLACDDPMLDTKVQTWADATGNAEVLDHE
HCGDPSLSYVAGKPRGTVPGCYRSVYEFMVAFNGGKVMETATGVVRVYDDTRPTFQDPPS
STTADCHSVPSFADVSASDTCMTSSPAVSKQEVRTDGACPYAYTLTRTWTTQDACGNENA
ATQVVTVQDVTKPTFTTRPTDRVLECSADVDADIEALRMKHVDAAASDLCSDTLLFETVE
TARDLSGCGGTGQVSVTVGFDGVSDPAVIAGSPGADFDVPDDRYELRFQVVNATDAEALA
LSALDAARVPTIEVEVNGDQVRAVVVTRLSGDHVAVLDAQPDVVNGTIVGPVSLNAQLAL
EDAIEALLRLVRRGEVEAIVLGRRVPAVTIETPYTSTTTTTTTTTTTTTTGTNATVTTIG
PGNKQTSKSSAAGTAAWQIAVAIVGGVVLIAAVVLAVIGRRRRGVSPPAAHKAAKERQTV
AFTNPAYDRPRDIASVNTAFYQDTTDADYDDNDLYDEPSVFRSKGCVVHNPLYLGEEAER
APEANAMYADASALRSTLPGFNPNFEFGDANGPVQEEYMTCDPNEARDEAYMEVADGNTS
ETYMEIGEDGAFMFGEEEDEYADIGELGFNEDDFMATLSQ
Download sequence
Identical sequences PTSG_08988T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]