SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08990T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08990T0
Domain Number 1 Region: 155-221,291-364
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.37e-16
Family Asparaginyl hydroxylase-like 0.022
Further Details:      
 
Domain Number 2 Region: 842-911
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000751
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 3 Region: 906-973
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000417
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 4 Region: 1024-1090
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000111
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 5 Region: 1225-1284
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000139
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 6 Region: 963-1035
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000528
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 7 Region: 1081-1139
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000347
Family Complement control module/SCR domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_08990T0
Sequence length 3227
Comment | PTSG_08990 | Salpingoeca rosetta conserved hypothetical protein (3228 aa)
Sequence
MSIAEMTSPVPVGAVTKHAPFSSTAAADVPVDTTTTNADTDTTNTDTDKPVPLSFGDFFT
GDRDVFFDSVYQHETLIDHRPTPDAFTPRLRQITTPLNQVQSLCHAFEQQDKQSGGFHIK
EQGETRQVSSCKQMEDELAAGAGLLIRYEDLVDSPAQDHVKQLQDGVRDVFGTESTVHLY
HATQNESRALMPHTDPYDVLVIQLHGSKRWTTCIPDAYVSDTDTNNDGSGTNAEDDDNAN
TGTGDHGASASASASSSFPSRHGTRARPSEAETIKHFNPAQLGQLQEIRRQRQQGCTAYQ
DADLRGMRCNEFTLRAGDTMYMPKGIIHFALSGEEGSSHLTISLERKGLAWADALMHAAL
SGADIVDNPAFLGHWKNTVQSLISDYRGVQLLEAMPSWHLNTGALCAARGQEQQQQLQQH
GDGSAAGGERDEAKAFLASFQSLCREVGPDVLETYTKANDLDAFLNADGIGALVERVCSE
ESAAAVVEQLCARGKMPVDVTSPRFRKMHVPQMERVRRATVTAAYTCNTGCDESCDTSSC
NLGCDGGCASGCDSGCTSCDTGCDICYSNCNTGCDVTTCTGSCDTGCDICTTGCDSLCDD
SCNTGCDTGCTLSCDTGCDTGCNTGCDWSCDSSCDSSCDFAGFSCDSSCDSSCDDTRCNL
GCDDSCDSSCTQSSCDTGCTTDCNGGCDTGCDGPCNTGCDDNCNTSCDECTYSSCDSSCD
GSCSCNPGYYGSGTSCTACGPNTYSASSGQSSCTPCGSCGSNQYRVNCGGSNDGSCTSCG
SCPAGSERTGCSGTSAGTCSPCDSGTYKTSQNNQPCSPCGSCAAGYYLAGCGGSSAGECV
GVQCNTPPSVSHGSVSSLSNNGRYPSTATYTCAPGYMLASSSDNKLQCQTDKTWAGTMPR
CIGVPCPGISIAHGSVSPSGTIRHPSTAGFSCNTGYVLMGATSAQCQADGTWSSPAPTCV
GRLCTLLDTPNHGSVSYTNSRQYPSTATYTCQAGYELSDTGDAQRSCIASTGGFGGTAPS
CVGVLCKPLSDPQNGHLRLSSTPARYPATAEFSCVPGYELVGQEQLSCKTDKTWSAPAPT
CRGVLCTAPSIDHAQVSATSGRYPADASVTCAPGYGLVGASTLSCRTDGTWGELPSCQLC
PANSYAPSPTQPCASCPSGTSTNGQTGATKCECIAGHEPSGDGSTCVPCQANHFKPDFGS
VSCQPCQSGFQTENGDFTRCVGVPCDPVRDIENGDPENTMMHRYPATVSYECDTGFQLVG
DVSSITCQTDGTWSALPSCTYICGDGLVVDGEECDDGNTDDGDGCSSTCQLEDTHACVDP
GEACVYCNFTSRPERLVLACDDPMLDTKVQTWADATGNAEVLDHEHCGDPSLSYVAGKPR
GTVPGCYRSVYEFMVAFNGGKVMETATGVVRVYDDTKPTFQGLPSSTTADCHSVPSFADV
SASDTCMASSPAVSKQEVRTDGACPYAYTLTRTWNTQDACGNENAATQVVTVQDVTKPTF
TTRPTDRVLECSADVDADIEALRMKHVDAAASDLCSDTLLFETVETARDLSGCGGTGQVS
LKVTVTDECGNPQEETVTVDVVDKTAPVPVNVPADVTVECSAIPPIADDVHARDACGLRR
VNATASEERQDGPCPHSYDLLRTFTFVDACDNPVSRTQRVTVQDTTGPVITRDADDLELE
CSAERNDDTIAAWLAVNGGAQAMDACSGVHTLTWTHDYDPQYYEVFPGGCSVGTGQVLVT
FTVADECGRTSTVNGSIKIVDTREPAFVAPLPPLTGACDAVPQATVPQAYDNCTGEVTPT
QTTTRMDGDCPHQYHLIHSWVAEDECGWTTTTQQTVTVTDAAAPTITKQSADRTVECSVA
DNEARLDAFLAEHGGAQATEVCGGVTWLYSDVDTVLDVAQGASGDVVAQDGCGTTFTATA
HFYAVDECSNAAKTTATFTVQDTLAPVLDTPPAASIDASCDAVPALSNISATDMCAGALV
AVASEERLDGRCTHTYTLSRTWMVQDPCGHMTTKSQLVHVDDSAEPVITKEAEDLVVECN
AETDSVIAAWLEAHGNAAAADACDRELTWQHDFESVKYLLQYGCGSNAVNVTFTVMDDCG
NAAETQARVVVQDTTAPFFTQLPSDDRAECDPTTNQNTLDAFLATYGGARASDVCGSVVG
QDVAWSYVVDLQTVCGNAYDSVVTFTATDHCGNNVSATATMAFEDTQKPVIKLRGADPQL
AQVGFPWLDPSVDLATDRCHQELTPFVEVVNPPNTTQVGNVTVFYRVEDACGYVGLANRT
VHVRDTLPPEVEVLGPGEMFVRAGSTFYDPGVRARDNVWPTVSVETVVVADGAESRAVHE
APQAQGREVFHVVYTVRDGSDNQVTQVGRTVHVLAAPERSPASSSATLSFDFGVTLAVAD
VPGGGAGGAGGRREVYSVARAVTSVSVDPAAHTLEADGLDVVLGGDVEDFVVEGGDGSSA
SPGAAYVELHVVVGGATADVVEAARASPKVEAMTELTRAVSFFGSMRNADGDCAGLDTIP
DALARHGRTYVSAECEGCLCVYEALEPSSEGEFDAPQLEETVQYHVTLRPSDNRAFNLAQ
LRLKLYELGVVPVLLRFEPTPAPTTTTTTSTTSAATTTDTTTSAAPTSAAAGGAGTAAAN
ATAVSGNATATVTATGGAGTSSSTTTTSTTTTTSTTTTTTQAVEAVTFVTRTPLPKGSDA
LLPARAVVENVRAVVATRVEMAVTPDLTRVTLLNQFYHLGIVPKTWSMEARESETVLVVV
TYNDVTAAAVATLENEVTRLRRPRGRATTRWTRPGVGANMTGAAAAVNETLHMQGLTQGV
DYRLHGCDGDVNASAACVIETRAALGGGVLLALEAWPAVVAVRDDGCVTLDDLLLASIKA
KLGGLLPYPVDRVTFSVDDPSLRRSSQVSVTVGFGGVSDPAVIAGSPGADFDVPDDRYEL
RFQVVNATDAEALALSALDAARVPTIEVEVNGDQVRAVVVTRLSGDHVAVLDAQPDVVNG
TIVGPVSLNAQLALEDAIEALLRLVRRGEVEAIVLGRRVPAAAKERQTVAFTNPAYDTPG
DITAWGADDTGEYQDFDAVQGDGNDLYDEPALAHGKGRVVHNPLYDGVDEDAAMLGMYAD
ASMLRSSGGGGGGEDDAGETYMAIGEEGAVLFGDEEEGVDEADYADLEEIGYLDVGPEAE
GDGADGDDADVEAMYEDMADTSDEEHGFGSDYDEVDGAQAAAEDSDE
Download sequence
Identical sequences PTSG_08990T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]