SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_08991T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_08991T0
Domain Number 1 Region: 695-763
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000208
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 759-826
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000826
Family Complement control module/SCR domain 0.00083
Further Details:      
 
Domain Number 3 Region: 128-185
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 0.000000165
Family Asparaginyl hydroxylase-like 0.019
Further Details:      
 
Weak hits

Sequence:  PTSG_08991T0
Domain Number - Region: 816-847
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0199
Family Complement control module/SCR domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PTSG_08991T0
Sequence length 852
Comment | PTSG_08991 | Salpingoeca rosetta conserved hypothetical protein (853 aa)
Sequence
MAADVPVDTTTTTTTTTNTDTDKPVPLSFGDFFTGDRDVFFDSVYQHETLIDHRPTPDAF
TPRLRQITTPLNQVQSLCHAFEQQDKQSGGFHIKEQGETRQVSSCKQMEDELAAGAGLLI
RYEDLVDSPAQDHVKQLQDGVRDVFGTESTVHLYHATQNESRALMPHTDPYDVLVIQLHG
SKRWTTCIPDAYVSDTDTNNDGSGTNAEDDDNANTGTGDHGASASASASSSSFPSRHGTR
ARPSEAETIKHFNPAQLGQLQEIRRQRQQGCTAYQDADLRGMRCNEFTLRADGIGALVER
VCSEESAAAVVEQLCARGKMPVDVTSPRFRKMHVPQMERVRRSTRTTAYTCDSSCDSSCD
TCDGSCDSSCDACDGSCDSSCDICDSSCDSGCNAGCDSSCDICDYGCDYSCDAGCDSGCD
SSCDSYCGSCDSSCDGSCDFFGWSCDSYCDSSCDSSPCSCDYSCDYGCDYGCDGGCDSGC
DRGCDYSCDTCYSSCDSSCNGGCDSSCDSSCNRGCDSSCDSSCSPVSCDSSCDSSCNGGC
DSSCDGPCNSNCDGSCDASCDSCTYSSCDSSCDGSCSCNPGYYGSGTSCTACGPNTYSAS
SGQSSCTPCGSCGSNQYRVNCGGSNDGSCTSCGSCPAGSERTGCSGTSAGTCSPCDSGTY
KTSQDNQPCSPCGSCAAGYYRAGCGGSSAGECVGVQCNTPPSVSHGSVSSLSNNGQYPST
ATYTCAPGYMLASSSDNKLQCQTDKTWAGTMPRCIGVPCPGISIAHGSVSPSGTIRHPST
AGFSCNTGYVLMGATSAQCQADGTWSSPAPTCVGRLCTLLDTPNHGSVSYTNSRQYPSTA
TYTCQAGTGTCA
Download sequence
Identical sequences PTSG_08991T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]