SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09037T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09037T0
Domain Number 1 Region: 163-290
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.37e-16
Family Pentraxin (pentaxin) 0.079
Further Details:      
 
Domain Number 2 Region: 481-508
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000662
Family Integrin beta EGF-like domains 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09037T0
Sequence length 710
Comment | PTSG_09037 | Salpingoeca rosetta hypothetical protein (711 aa)
Sequence
MATVAEAVFGDLGFPRGWSGPVATVVPTENERQAWIATDPQITETSCVECTSPPYYIHGP
NGGRDSYALSFNTFLSFMHYKYPDRLPVDGIRRADTAGLLRGQSLFISGNQLRGETDTNC
PQFPNGWCTGESMSAADIYVSTVRAVAPTTMHAPATQPIFVPNTNGSLDITDKLTVEVWV
KCLTPPRPQPDGRTYAPLLTKNGRIGVNQDTFAMYHVVGVYDGRDLVVYVNGVEQGRTTI
GAVVAYTGPEAMVIGSNKHTNHGSKGSVHAILDEVAVWNRVLDGAEVAASVFVPITDRQQ
TPTNDNNDDGSSSNNNNNNNNNKLVAYINFEQPEQWLDLSPMWTETASGAELLRSQHVPD
VGPLSLNASTANLVLVPSVDQSQHAAFFYDEDLDMEFFPRVPDGEYVAFVSTASLQCETD
AGCLCNTSLLVNAASVWDNTVTVQLRADNYHVCHSFTGEPDTFYMQPGPRVSAVDLDPCF
GVTCGSHGACRQGACVCTDGYTGDLCHLPPPVFSNNGTTPQQPARSCADVADLPKAAGLY
FVSDDPNAPVAGAASPALCLQAPNGVDAYRVASVIASPTGTTMAALTRAGGLSAVNELST
SATFAQPLSSAAFDRTAVACLDADERVVEATLTPVHASTFSRFVSGAWSYLSQETAQNGT
IVTFTGGEDSAPKTVTIETAQDTQYTWSDAGFVCAGLPVTRAWRLAILVA
Download sequence
Identical sequences PTSG_09037T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]