SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09047T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09047T0
Domain Number 1 Region: 721-761
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000366
Family EGF-type module 0.008
Further Details:      
 
Domain Number 2 Region: 577-693
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000157
Family Growth factor receptor domain 0.0065
Further Details:      
 
Domain Number 3 Region: 254-293
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000273
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  PTSG_09047T0
Domain Number - Region: 761-878
Classification Level Classification E-value
Superfamily Cadherin-like 0.00014
Family Cadherin 0.016
Further Details:      
 
Domain Number - Region: 887-956
Classification Level Classification E-value
Superfamily Cadherin-like 0.000209
Family Cadherin 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PTSG_09047T0
Sequence length 983
Comment | PTSG_09047 | Salpingoeca rosetta conserved hypothetical protein (984 aa)
Sequence
MAIGTVTATLAFTDPEGTPVSVVAGSQDSAFVAVDGASIVFAAPINSNASDDVDDSPATR
AGIAISDRGVARTRTRQCDRGVARTPVSVAVLLLWLLLLLLWLLLLLWLWLSLLLLLSLL
HAALHCTPHCTARRTALHAALHTDTHKHHCTRESMSTYRLLSDSATDTPSVTDPLDVIPI
VLLTIVLFATVICTEAAAASPSQTTVAPKAVASRIGWAFESKRASGSNNDARNHRQFKVA
DRRLFTAQLLRVYEAEDGCASAPCVHGTCIDTPAAYACNCTGTGFFGPQCQHLITCNVTQ
DTTPQFSAQLFPEAPDNSIADDERAVFQRLSGFRSSASEDGPALVFRTCTASGRLACSAA
TTAHARTLSSQLFPDTIDTETALDVVDVLVVAQDRDLSTLPIDNITIGNLLITETSCHPV
QHSRAAAAGGTTPPPTSTPLSFPVATCESSSPCVRGTCTTRAGFIVCFAANETSAYTSTQ
LRQATLTALSSIPNTAGVWQTTGVTSTTDERCVHVLASEQVPGNSSVLAEVEYRVATSIF
TIVHPASATAPQATARRDPLTYDVTTALPAGTRIKAFGCACPTGFEGDTCADNIDDCSPN
PCWPGTCTDLVADFTCSCEGTGFQGDLTLTTLLPPDSTPAYMTSFTRTCRADQTYTNTEL
ACRDVNECDPDAQHQPRTYQQQALYTCDDGYTTTGDAQATATYTATCTATGNYTFQGTCV
EVDECAAQPCMNGGVCTDLVNAFECACVGEWGGPTCSDDTNRPPERISLSTTRVPENTFP
LPLVTVTVEDPDTHQSHTLQVLSSTPRACQRTPSRWTNGGSCSGGSGGAGAASPTLEITR
ALDFEVDGSAIEAVVRATDNGTISHLSADFLVRINVEDNNDAPTAVLLDTTSIAESMPAG
TLVSRISTVDQDAGDIFTYALVSPQGSTAAAAFQIMGDMLLVKSAAPLNHEANPVVTTSA
LLLWRVLAARAQGTAVAAAATCR
Download sequence
Identical sequences PTSG_09047T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]