SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09048T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PTSG_09048T0
Domain Number 1 Region: 112-160
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000171
Family Cadherin 0.032
Further Details:      
 
Weak hits

Sequence:  PTSG_09048T0
Domain Number - Region: 14-94
Classification Level Classification E-value
Superfamily Cadherin-like 0.051
Family Cadherin 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09048T0
Sequence length 408
Comment | PTSG_09048 | Salpingoeca rosetta hypothetical protein (409 aa)
Sequence
MLKVDVTTAPLLWMVGAVHVLDPDTADATADPQPFVFDVSPAGVAYIENQPLFVNRSSLD
FESQSSFVIINVTARDARDSSLAVSQQFTLLVQDLNESPTSDVPNGTATDRRTVQLVLAA
GATLNYEVRSVFVVTVTATDQGGLSATSQILVFVQDRNDAPTTPTITSNRLPENTTALPF
VVGTLQATDEDTSQALQFAINSIDLRHGHWRNTSTGPRTCACQAMPTSGVALACTTATNS
RYAVVLVMLMSDACMSAGCAWSDVCGSNSNDDGGYCGVFEGDLEATAQHPTDGKCTGTDK
DLCEAEDGCAWDVSGHCHLRSCTAISDATKCDSQDSCEWHMHCSSADDGGQSPGSSICEK
YVCKDVISHCTGGCNVMFQCVLAMARREQCERRRQLHQGVPQHVEDDG
Download sequence
Identical sequences F2UM22
XP_004989847.1.12839 PTSG_09048T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]