SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PTSG_09083T0 from Proterospongia sp. ATCC 50818

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PTSG_09083T0
Domain Number - Region: 1996-2084
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00122
Family Cellulose-binding domain family III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PTSG_09083T0
Sequence length 3209
Comment | PTSG_09083 | Salpingoeca rosetta conserved hypothetical protein (3210 aa)
Sequence
MSSAPQSLVSLSHTSSSSRPRLRFLLILLFSALLGFATFTHGAAETTTGSTIQPIITFPQ
TTTQQECIPAPQYLIDVATCKQMCSGSYQNDERTICWAGCDWYNDGGDEYCKCACSQGVP
RSDLQNPCVTGCGFADDTSKVLLCPANEFAQVENDGSQSCTPVTACSTATEYQVVAPTAS
SDRQCAVLSTCSPSQYEVTAATATSDRECQDVSVCDRRTEFEQQPPTTTSDRECATITIC
EAATQYETKAPTSTSDRECAPVTICTRGTEFEVTPPTATTDRVCQLITQCDPQSEYQTVS
PTFNSDRECAALTTCSVDTEYESTPPTATTDRTCSNLTVCGASQFEAQAATATSDRTCQD
ITICLRATQYEQAPPTTTSDRECQDVSVCDRRTEFEQHAPTATSDRECATITTCNARTEY
ETKAPTSTTDRECTTLTPCVRGEEYQSVGPTATSDRECTPITHCHVLGKYQTIPATFSTD
AVCANLSRCDATTQYELGAPTATSDRVCDDLASCNIDQYETAAPTATSDRTCANVTVCDA
ATEYETAAPTATSDRTCANVNTCSIEQYETAAPTATSDRTCANVTACDAATQYETAAPTA
TSDRTCANVTACDAAAEYETAAPTATSDRTCANVTVCDAATQYETAAPTATSDRTCANVT
ACDAAAEYETVAPTATSDRACANVTACDTATEYETVAPTATSDRTCANVTACDAATEYET
VAPTATSDRTCANVTACDAATEYETAAPTATSDRTCANVTACDTATQYEIAAPTATSDRT
CSNVNTCSIEQYETAAPTATSDRECANLTVCDPATQFQATAPTSVSDRQCANITACGAAT
QYETAAATPTSDRTCARLLLCGPSQYEVRAPTPTTDRVCQTANFTSVVHATVTTQTVASG
LAPAAARVPFSQPALLPVSVAGTGRAEVALPNTDVAASATYSLAAVAALNITDAITATAD
VYHDSSSVVIHARVADALGDTTNILPGTLTAEVVADAQLTTALTTVGSTAPHTLTCTCAV
RSQTHGLCQATCSVPQDWFTALAVGTTASASIAVQASSTGSARASPRRTIAAVTVHGSSA
AVTPPTNAIFLRLPEAPVAPGDAATVQVGARLSAFPLGGFVVKLECADAAGKATFGAVAI
DDTTWSSFAAGEGTSAVSIGAVLAEGAAQVSGQDDAAVLFTVALNLDDDAATTVQTLLNI
NLTVSEVLDNANNIRTTATRTYAVDFTGLASSVLSSAGPVTGAVRIRPVRAVGAVSFVST
TPRILNTAPLTGVSDAAAFSIDTRLVLSDGQLVSTATSALAATTTVQQCAVASGPPTLVS
LEQDCSGGVVSTLDTSGGTAVLEISTTTTLGRAAAAVLTRRVLVEVWSPRLPLMVATAPS
VLRPIAGWREPAANSANSSTCDAPRWQTPHVQVTATFASGDQEVSAVDVTGLVAAGITAN
DTTVLAAANEDEVGVAALRPLRALRSGAVRVMVVRAGDGIGSGTVLGEAAQATVVVDPAT
TPDAYIGWQGIDAVAVSNVDLRPVSGSDPAGAGWLDAVVFEVAVATHALRAEGASTALLA
SLVLEDGWREPLVPARDVLFTSMAADQITIDAGNRATVAVGATSGSRELVAAQLTSTAVD
AATGNNAACVPRVRANVTLDLDLPAPTGVRVSGVVSRITPAGDAAALAGIATGFSIGVAV
AFEDGTERDMTTDGRVTATVAPSAAGATVERGANGALRVEAIAAAPNSPSISLVTVAFDG
GNGPASVVNTTFQVLTVKYTALRTTARPFPAYAGSQSVSVTELAPINGTAPLQYQRAQLA
TAMMLDDGSELALDAGDVVYAVRRADDDDSAAQLLQGAVVEPSTPGNITVLATAFGSFEE
SPRFGLSVVDDAVHVVALRSLSTTSGIALTSQQGQTAGFAVCAAELSDGTQLPQLYSNGR
AQYPSLIQLSVSDADVLRINSTTGEVVLLANSPGVLQIVAQVTSAPSVVTTTDVSCNLQP
ALGDVDVGQMSGVPVPGPLSIGDELQVQVRVNTGSTDIGSFTMELQYDASIVSFVGADAT
FGGSLEATDDGQGSLRLGGVVSSSGVGGSAAAIAHVTFQAVSAGAFVVEGAVTDLLDRQL
PSQPIVAGLPSAVVAGRVWISVTGADGGEQQRRRRSGVRLPVPPPQSLAQPRRRRNADSD
PFASAADVDGDGRFTIGDAFFTLRYVVLETQEFAGADGAAVQAILAEDPRRRSALDADRD
GTVRLRDSRLQSQVATGKAVFLGSIPGVDVAVNQDTSACGVSVSATVFEPGLGGAAASST
RVFVLVDGLAQDGGTTATLLSLPGTGTGIDVAQLSPALSDAVAVYGSEPGAQAVLLEAVP
SNASAPVSAVYTALLPPAVDTQLIGVSVFAVVSRGVRTYATFFGNQATTGAPVVPSRRTE
TVRAFANADVDAAVLDTGLDSGYNPLTTAALNNTRAQQYCIRQCVATGDDVVSAYFYNTT
AFTCVSTSTCDTLSEYESEPATSTSNRECEPLRACDAATEYETAAPTATSDRTCANVTAC
DAATEYETAAPTATSDRTCANVTACDAATEYETAAPTATSDRTCANVTACDAATEYETEA
PTATSDRTCANVTACDAATEYETAAPTATSDRTCANVTACDAATEYETEAPTATSDRTCS
NVNTCSIEQYETAAPTATSDRTCANVTSCAGDQYEIAAPTATSDRTCANVTACDAATEYE
TAAPTATSDRTCANVTACDTATQYEIAAPTATSDRTCSNVNTCSIEQYETAAPTATSDRE
CANLTVCDPVTQFQATAPTATSDRLCANLTSSSTQSPTAAAAIASVQIPEASNLGLAVSV
LGALVCCFGLVRTVRTPVWPLFLSLALCHVYFGVESVALSDDISFSLVADRCLALGAFKL
ALSLSCLCWLGACVLQSSTDINPFTLRPLGLFAIVCAIPITTAVALVAAAPSSFGASTGW
CDLHQPLARGLAGILASCTLGFSPLIYASIRRIRHRRQFFMGDIVDDLFGNESRIQRPLL
AAAILLVVANRVSLNLPVHLSVDDDIPEHMPVVNVMCAVALTAVSLVFLCTRLGRSDNNG
SNKGGLAGYASPNNSGDPSKFVHLNTMPADDVPRSFVSRISKRGAFSPSTPAHLPGSISR
SMLTSFRYLPRYENDSSSDDVSGMSISDKVHEDVSGIHEDTSSSSILRGLTSLDISDGGE
SIDLFPVAIDRQEVENADVESIEDNVVVV
Download sequence
Identical sequences F2UM60
PTSG_09083T0 XP_004989885.1.12839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]